KEGG   Campylobacter coli CVM N29710: G157_06865Help
Entry
G157_06865        CDS       T02838                                 

Definition
(GenBank) Ferredoxin
Organism
ccc  Campylobacter coli CVM N29710
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_2 Fer4_16 Fer4_9 Fer4 Fer4_21 Fer4_10
Motif
Other DBs
NCBI-ProteinID: AGV10463
LinkDB All DBs
Position
1384315..1384560
Genome map
AA seq 81 aa AA seqDB search
MALLITKDCVCCDACREECPDEAIYEHSPIYVIDADLCSECVNDFSEPACIVACPYECII
PDPDNVESIEELKLKNRNREF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctcttttgattactaaagattgcgtatgttgtgatgcttgtagagaagagtgtccg
gatgaggctatttatgaacatagtcctatctatgtgattgatgctgatctttgttcagag
tgtgttaatgatttttcagaacctgcttgtatagtggcatgtccttatgaatgtatcata
cctgatcctgataatgttgaaagcatagaagagttaaaattaaaaaatcgtaatagagaa
ttttaa

DBGET integrated database retrieval system