KEGG   Campylobacter coli CVM N29710: G157_06910Help
Entry
G157_06910        CDS       T02838                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
ccc  Campylobacter coli CVM N29710
Pathway
ccc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccc01100  Metabolic pathways
ccc01110  Biosynthesis of secondary metabolites
ccc01130  Biosynthesis of antibiotics
ccc01230  Biosynthesis of amino acids
ccc02024  Quorum sensing
Module
ccc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    G157_06910
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    G157_06910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G157_06910
Enzymes [BR:ccc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     G157_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N SKICH
Motif
Other DBs
NCBI-ProteinID: AGV10472
LinkDB All DBs
Position
complement(1391705..1392946)
Genome map
AA seq 413 aa AA seqDB search
MLEMKANLYYRQILKEFPSSYFAEDSTRVIIGIDCDFYDAKDITLSELKAKFYENASREQ
ICKYSGFFGVFSANFISLFENLPSNENKNYDFPNFLFANAKAYLVYEKTSKMFFKYGENK
YFDFLKEDFVFDKKVCEYKILQDFQEEKRDFIQSVEKAKEYLLSGDIFQVVLSKQLCIEH
NFDSFEFYETLSELNPSAYMFYFPTQYGVVLGSSPEFLLKIKNKEIFLAPIAGTRNLDEN
SDILKLEKDLLSDEKELSEHKMLVDLARNDASKFGTNTRVENLFSITRNKFVMHIVSEVY
ATMDKQANIFDIIGAVFPAGTLSGAPKIRALEIINELENLDRGVYGGAVGFLNFNEDVVL
AIIIRSAFFKENKAFIASGAGIVLQSDPQKEYEEICAKRKALLVSFEKMAKRS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaatgaaagcaaatttatattataggcaaattttaaaagaatttccttcttct
tactttgctgaagattctactagggttattataggtattgattgcgatttttatgatgct
aaggatatcactcttagcgaattaaaggcgaaattttatgaaaatgcttcaagggagcaa
atttgcaaatattctggattttttggtgtttttagtgcaaattttatttctttgtttgag
aatttaccctcaaatgaaaataaaaattatgattttccaaattttttatttgccaatgct
aaagcttatttggtttatgaaaaaactagcaaaatgttttttaaatacggagaaaataag
tattttgattttttaaaagaagattttgttttcgataaaaaagtttgcgaatataaaatc
ttgcaggattttcaagaagaaaaaagagattttatccaaagtgtggaaaaagccaaggaa
tatcttttaagcggagatatttttcaagtggttttaagcaagcagctttgcatagagcat
aattttgatagttttgaattttatgaaactttaagtgagttaaatcctagtgcttatatg
ttttattttccgactcaatatggggttgtgttaggttcttctccagagtttttactgaaa
ataaaaaacaaagaaatttttttagctcctatagcaggtactcgaaatttggatgaaaat
tcagatattttaaaattagaaaaagatcttttaagcgatgaaaaagaattgagtgagcat
aaaatgcttgttgatttagctagaaatgatgcatctaaattcggtacaaatacgcgagtt
gaaaatctttttagtataacaagaaataaatttgtcatgcatatagtcagtgaagtttat
gcgacgatggataagcaagccaatatttttgatattataggagcggtttttccagcagga
actttaagtggtgccccaaagattagagctttagaaattatcaatgagcttgaaaattta
gacagaggagtttatggaggcgctgttgggtttttaaattttaatgaagatgtggtttta
gctattatcataagatcggctttttttaaagaaaataaagcttttatagcaagtggagcg
ggtatagttttacaaagtgatccacaaaaagaatatgaagaaatttgcgctaagcgtaaa
gctttattagtaagttttgaaaaaatggctaaaaggagttaa

DBGET integrated database retrieval system