KEGG   Campylobacter coli CVM N29710: G157_07285Help
Entry
G157_07285        CDS       T02838                                 

Definition
(GenBank) purine-binding chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
ccc  Campylobacter coli CVM N29710
Pathway
ccc02020  Two-component system
ccc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G157_07285
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    G157_07285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ccc02035]
    G157_07285
Bacterial motility proteins [BR:ccc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    G157_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW
Motif
Other DBs
NCBI-ProteinID: AGV10541
LinkDB All DBs
Position
1454223..1454744
Genome map
AA seq 173 aa AA seqDB search
MSNEKLEQILQKQQTQIAGPVGDQKEDDIIQLVGFVVGDEEYAIPILNIQEIIKPIEYTR
VPSVPDYVLGVFNMRGNVMPLIDLAQRFNLGSSKMTPQTRYIVLRGESNGSGVGGNAGFV
IDRLTEAIKIHRNRIDPPPETLVKDKGMIYGIGKRDENILTILKVEALLKREF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaaaattagagcaaatattgcaaaaacagcaaactcagatagctggtcct
gttggtgatcaaaaagaagatgatatcatacaacttgtaggttttgtcgtaggagatgag
gaatatgctattccaattcttaacatacaagaaatcatcaaacctatagaatatacaagg
gttccaagcgttcctgattatgttttgggtgtatttaatatgcgtggaaatgttatgcca
ttaattgatttggcacagcgttttaatctaggaagttctaaaatgactcctcaaactcgt
tatattgttttaagaggcgaatccaatggaagtggtgttggaggaaatgcgggctttgta
atagatagactaaccgaggctatcaaaattcatagaaaccgtatcgatccgccacctgaa
actttggtaaaagataagggtatgatctatggtataggcaaaagagatgaaaatatcctt
accatacttaaagttgaagccttacttaagcgtgaattttaa

DBGET integrated database retrieval system