KEGG   Campylobacter coli CVM N29710: G157_07390Help
Entry
G157_07390        CDS       T02838                                 

Definition
(GenBank) anti-oxidant AhpCTSA family protein
  KO
K03564  peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
ccc  Campylobacter coli CVM N29710
Brite
KEGG Orthology (KO) [BR:ccc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G157_07390
Enzymes [BR:ccc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     G157_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin SCO1-SenC SpdB Thioredoxin_8
Motif
Other DBs
NCBI-ProteinID: AGV10558
LinkDB All DBs
Position
complement(1474040..1474498)
Genome map
AA seq 152 aa AA seqDB search
MSVLKVGDEAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGCTTEACDFSANYDKF
CDKNAVIIGVSPDGVTSHDKFIAKFNLKHILLSDSEKEVAKAYGAWGLKKNYGKEYEGII
RSTFVIDEAGKIAQIYSNVRVKDHALKVLESL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttaaaagtaggggatgaggcgccacaatttgaacttttaaatcaagatggg
gtgaaaatcgctcttaaagattttattggtaaaaaagtgattttatatttttatcctaag
gacaatactccaggttgcaccacagaagcttgcgattttagtgcaaattatgataagttt
tgtgataaaaatgcagtgattatcggtgtaagtcctgatggtgtgacaagtcatgataaa
tttattgctaaatttaatttaaagcacatattattaagcgatagcgaaaaagaagtggca
aaagcttatggagcttggggacttaagaaaaattatggtaaagaatatgaaggcattata
agatcgacttttgttatcgatgaagcgggaaaaattgcccaaatttatagcaatgtccgc
gtaaaagatcatgcactaaaagtgcttgaaagtctttaa

DBGET integrated database retrieval system