KEGG   Campylobacter coli CVM N29710: G157_07425Help
Entry
G157_07425        CDS       T02838                                 

Definition
(GenBank) hypothetical protein
Organism
ccc  Campylobacter coli CVM N29710
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 RrnaAD MTS TehB Methyltransf_12 Ubie_methyltran Cons_hypoth95 FtsJ Methyltransf_18 Methyltransf_4 GidB Methyltransf_15 PrmA Methyltransf_16 Methyltr_RsmB-F Methyltransf_32 Phage_holin_6_1 PCMT Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AGV10565
LinkDB All DBs
Position
1480440..1481150
Genome map
AA seq 236 aa AA seqDB search
MNLWDKKAKSYARYNQKLNSIQEQSFKELEKLNISFKDKKIIDIGCGTGVWTLYLAQNAK
ETTALDNAKAMLEILKEDANKLQLTNIKYENCTFTEWINKNQNAQFDIAFLSMSPALQDK
KDYLNFMRLAKIRIYLGWADYRKSDFLDPIFKHFNTEFKGIYKQDLESYLLENNVKFHKF
IFDETRIVERKKDEAIENTLWHLNMNGVKASKQDLETFVKGDIKETIQSKIKLLVF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttgggataaaaaagctaagagctacgcaagatacaatcaaaaactcaattcc
atacaagagcaaagttttaaagaattagaaaaactaaatataagctttaaagataaaaag
attatagatataggttgtggcacaggagtatggactttgtacttagcacaaaatgcaaaa
gaaaccactgctcttgataatgcaaaagctatgttagaaattttaaaagaagatgctaac
aagctccaactaacaaatatcaaatacgaaaattgcacttttacagaatggataaataaa
aatcaaaacgctcaatttgacatagcatttttaagtatgtcccctgctttgcaagataaa
aaagactatttaaactttatgcgattggctaaaattcgaatttatcttggctgggccgat
tatagaaagagtgattttttagatcctatatttaaacattttaatacagaatttaagggt
atttataaacaagatttggaaagttatttgttagaaaataatgtgaaatttcataaattt
atctttgatgaaacacgcatagtagaaagaaaaaaagatgaagccatagaaaataccttg
tggcatttaaatatgaatggagttaaagcttctaagcaagatttagaaacttttgtgaaa
ggcgatatcaaagaaaccatacaatcaaaaatcaaacttttggttttttaa

DBGET integrated database retrieval system