KEGG   Campylobacter coli CVM N29710: G157_07460Help
Entry
G157_07460        CDS       T02838                                 

Definition
(GenBank) hypothetical protein
Organism
ccc  Campylobacter coli CVM N29710
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGV10572
LinkDB All DBs
Position
complement(1485852..1486988)
Genome map
AA seq 378 aa AA seqDB search
MKNTLIIFENSLSNLKKDEVKDLLEDLSFNLAYKQISQDPHSTKKILNSLLVEFLTILKK
LDLFDDENVAKVIKALVKASVGDAQNVLYEYISEAELLNKQIENQKNLIKNQISDNFLEF
ENILQECSFCDEFSSGLNDAILFDIEMLGILKETAESAFLTTLEKAEDIELTSSEIAKSL
VYNAICEAHFEKERILKISSIILNTAFEIANESIAYAKDLCLGAIKGTRDGISLAMEKFK
TTLAYAKFEEDVSLKSKELIGIEDDFIALLKREIKEQKNPSKDIVENLLEHELDNLFAKF
KRLAVESREQLLLVLNDIKKNPKINDFNRLTQRKLHRFKQEILELEKVAGEKYKELNSKK
AKKLGVRLWERAKKLIKK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactttgattatatttgagaattctttatccaatctcaaaaaagatgaagtg
aaagacttgcttgaggatttaagttttaatcttgcgtataagcaaatttcacaagatcca
cacagcactaaaaagattttaaattcacttttggttgagtttttaaccattttgaaaaaa
cttgatttatttgatgatgaaaatgttgcaaaagttatcaaagctttggtaaaagctagt
gtaggagatgctcaaaatgtcctttatgaatacatcagcgaggcagaattattaaacaaa
caaatcgaaaatcaaaagaatttaattaaaaatcaaatcagtgataatttccttgaattt
gaaaatatcttacaagaatgttctttttgcgatgaatttagcagcggattaaatgatgcg
attttatttgatatagaaatgcttggaattttaaaagaaactgctgaaagtgctttttta
actactcttgaaaaagctgaagatatagaacttactagcagtgaaattgccaaaagtctt
gtttacaatgctatttgcgaggcacattttgaaaaagagcgtattttaaaaatttcaagt
attattttaaatacagcttttgagatagcaaatgaatctatagcttatgctaaagatctt
tgtcttggtgcgattaaagggactagagatggaatttctttagctatggaaaaatttaaa
accacacttgcttacgcaaaattcgaagaagatgtgagtttaaaaagtaaagagttaata
ggcatagaagatgattttatcgcacttttaaaaagagaaattaaagaacaaaaaaatcca
tcaaaggatatagttgaaaatttattagagcatgagcttgataatctttttgctaaattc
aaacgccttgctgttgagagtagggagcaattgcttttggttttaaatgatatcaagaaa
aacccaaaaatcaatgattttaatagactaactcaaagaaaactgcatcgctttaagcaa
gaaattcttgagcttgagaaagtagcaggggaaaaatacaaagaattaaattcaaaaaaa
gctaaaaagttaggcgtaagactttgggaaagggcaaaaaaactcattaaaaaataa

DBGET integrated database retrieval system