KEGG   Campylobacter coli CVM N29710: G157_07560Help
Entry
G157_07560        CDS       T02838                                 

Definition
(GenBank) Putative acetyltransferase
Organism
ccc  Campylobacter coli CVM N29710
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 Fucokinase
Motif
Other DBs
NCBI-ProteinID: AGV10592
LinkDB All DBs
Position
complement(1503182..1503721)
Genome map
AA seq 179 aa AA seqDB search
MLIRFKDKFPNLGQNVFVAEGAKIIGEVEIGDESSVWFNCVLRGDVNFIKIGKRTNIQDL
TTIHVWHREFNKDGSLKDAGFPTCIGDDVTIGHNCVIHACKIGSRVLVGMNAVIMDDAAI
GDDSIVGAGSVVTKGKKFPPKSLILGNPAKLIRELSDEEVAFLKQSALNYVEFKNDFLD
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcttattcgatttaaagataaatttccaaatttgggtcaaaatgtctttgttgcagag
ggtgctaagattataggagaagtagagataggtgatgaaagcagtgtgtggtttaattgt
gttctaagaggcgatgttaattttattaaaatcggtaaaagaacaaatatacaagattta
accactatccatgtgtggcatagagaatttaataaagatggaagtttaaaagatgcaggc
tttcctacttgcataggagatgatgttactatagggcataattgcgtgatccatgcttgc
aagatcggctctcgtgtgcttgtggggatgaatgcagtgattatggatgatgcagctata
ggagatgatagtatagtgggtgcaggtagtgtggtaaccaaaggcaagaaatttccaccc
aaatcactcatacttggaaaccctgcaaaacttatacgcgaactaagcgatgaagaagtg
gcatttttaaaacaatctgctttaaattatgttgaatttaaaaatgattttttggattga

DBGET integrated database retrieval system