KEGG   Campylobacter coli CVM N29710: G157_07595Help
Entry
G157_07595        CDS       T02838                                 

Gene name
infC
Definition
(GenBank) translation initiation factor IF-3
  KO
K02520  translation initiation factor IF-3
Organism
ccc  Campylobacter coli CVM N29710
Brite
KEGG Orthology (KO) [BR:ccc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccc03012]
    G157_07595 (infC)
   03029 Mitochondrial biogenesis [BR:ccc03029]
    G157_07595 (infC)
Translation factors [BR:ccc03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    G157_07595 (infC)
 Prokaryotic type
   G157_07595 (infC)
Mitochondrial biogenesis [BR:ccc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    G157_07595 (infC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF3_N IF3_C
Motif
Other DBs
NCBI-ProteinID: AGV10599
LinkDB All DBs
Position
complement(1509352..1509870)
Genome map
AA seq 172 aa AA seqDB search
MSKEKEVLLNEEIRADEIRCIGDDGKAYGIISSDEALEIANRLGLDLVMIAADAKPPVCK
IMDYGKFRYQQEKKQKEAKKKQKVIDIKEIKLSVKIAQNDINYKVKHALEFLEQGKHVRF
RVFLKGREMATPEAGVALLEKIWTMIENDANRDKEPNFEGRYVNMLVTPKKA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagaaaaagaagtattgctcaacgaagaaattagagcggacgaaatcagatgt
ataggtgatgatggcaaagcatatggcattatcagcagtgatgaagctttagagattgca
aatcgtttaggacttgatcttgtaatgatagctgcagatgcaaagccacctgtttgtaag
attatggattatggaaaattccgttatcagcaagaaaaaaagcaaaaagaagcaaagaaa
aaacaaaaagtaatcgatattaaagagattaaactttctgtgaaaattgctcaaaatgat
ataaattacaaagtaaaacatgctttagaatttttagaacaaggtaagcatgtgagattt
cgtgtgttcttaaaagggcgtgaaatggcgactcctgaagcaggtgtagctttgcttgaa
aaaatttggactatgatagagaatgatgctaatcgtgataaagagccaaattttgaagga
cgctatgttaatatgcttgtaactccaaaaaaagcttaa

DBGET integrated database retrieval system