KEGG   Campylobacter coli CVM N29710: G157_07640Help
Entry
G157_07640        CDS       T02838                                 

Definition
(GenBank) Putative periplasmic protein
Organism
ccc  Campylobacter coli CVM N29710
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGV10605
LinkDB All DBs
Position
1523113..1524261
Genome map
AA seq 382 aa AA seqDB search
MKKLLIIPIIIFLCFIAQIFYMGHINESFFYNLTQTQNPYYEIKNINFHKGFLNSKADFT
IEDKYNLGLISKLDFKFNNNYFSKFIAQGKLSNPFKLLDDKLQNKELAWFKIQSIQNDLN
VSIQFQDINLSNEGGNALWENVLTEILLDKEDLKIKAIYSKIGQVDFSQFYAKFYLKNLD
HQQKFEKPISFSNLIQFNESVEEFKFDFCEINNHTISSFYNKNIIYFDDDNQTLKMHSQG
KANNLNIDLTSQIYQSIDFDQINFDLIYSQKKPDISDDKLIFKPSNEELNLQIQNITLKK
DNQDINIKGNIFLSMQSHKAHIQISSLKSPDEIFTWGQFFGGLNQYFIKNEEGMFIMDLH
YDSDAKTQLKINGNEFTDINLN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaactacttataattcctattattatctttctttgcttcattgcgcaaattttt
tatatgggacatattaatgaaagttttttttataatcttactcaaacacaaaatccctat
tatgagataaaaaatatcaatttccataaaggttttttaaattcaaaggctgattttacc
atagaagacaagtataatttaggtttaatttcaaagcttgattttaaatttaacaataat
tatttttcaaaatttatagcacaaggaaaacttagcaatcccttcaaactcttagatgat
aaattacaaaataaagaattagcttggtttaagatacaatctattcaaaatgatcttaat
gtatcgattcaatttcaagatatcaatttaagcaatgaaggtggaaatgcattatgggaa
aatgttttaactgaaattttactggataaagaagatttaaaaattaaagctatttattca
aaaataggtcaagttgatttttctcaattttatgcaaaattctatctaaaaaacctagac
catcaacaaaaatttgaaaaacctatatcgttttctaatttaatacaatttaacgaaagt
gtagaagagtttaaatttgatttttgcgaaatcaataatcatacaatctcttcattttat
aataaaaatattatttattttgatgatgataatcaaaccttgaaaatgcattctcaaggc
aaagcaaataatctaaatatagatttaacttctcaaatttatcaaagtattgattttgat
caaatcaattttgatctcatttatagtcaaaaaaaacctgatatttctgatgataaattg
atttttaaaccttccaatgaagaattaaacttacaaatacaaaatatcactttaaaaaaa
gataatcaagatataaacatcaaaggaaatatctttttatcaatgcaaagtcataaagct
catattcaaatttctagtttaaaatcgcccgatgaaatctttacttgggggcaatttttt
ggaggtttaaatcaatactttataaaaaatgaagagggtatgtttatcatggatcttcat
tatgatagtgatgctaaaactcagcttaaaatcaatggcaatgaatttacggatataaat
ttaaactga

DBGET integrated database retrieval system