KEGG   Ruminiclostridium cellulolyticum: Ccel_0283Help
Entry
Ccel_0283         CDS       T00835                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cce  Ruminiclostridium cellulolyticum
Pathway
cce00473  D-Alanine metabolism
cce00550  Peptidoglycan biosynthesis
cce01100  Metabolic pathways
cce01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ccel_0283
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ccel_0283
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ccel_0283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cce01011]
    Ccel_0283
Enzymes [BR:cce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ccel_0283
Peptidoglycan biosynthesis and degradation proteins [BR:cce01011]
 Precursor biosynthesis
  Amino acid ligase
   Ccel_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ACL74670
UniProt: B8I590
LinkDB All DBs
Position
321360..322490
Genome map
AA seq 376 aa AA seqDB search
MSKKRVAIIFGGQSSEHEVSRVSAQSVIENIDKQKYDVEIIGITKSGQWLKYDGPVEKIG
NGDWEAIAQKKPVESLSQAGISSSGITTVNSVRQIMPGNVKAPIDVIFPVLHGCNGEDGT
IQGLFELAGIPYVGCGVLGSAVGMDKAYTKIIFEKEGLPQGDYLVFNRKQVYNRIEDVVA
QIEGRLTYPCFVKPSNAGSSVGVNKASDRESLVKALNIAAKNDRRILVEEFINGREIECA
VLGNDNPVASTVGEVVPCNDFYDYEAKYQVGDSSKVVIPAPNLSKETVEKIREYAVRAFK
CLDCAGLSRVDFFVHKETGEIYINEINTLPGFTQISMYPKLWAASGIPYSELINKLIELA
FERYEDTRREYTNTLD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaaacgtgtagctattatttttggcgggcagtcatccgagcatgaagtttca
agagtatcggcccagtcagtaatagaaaatatagacaagcagaaatatgatgttgaaatt
ataggaattactaaaagcggacaatggctaaaatatgacggaccggttgaaaaaataggg
aacggtgactgggaagccattgcacaaaaaaagccagtggaaagcctatctcaggcaggt
atatcttcttccggaataactacggtaaattccgtgagacagataatgccagggaatgta
aaagctcccatagatgttatattccctgtattacatggttgcaatggtgaggatgggact
attcagggactttttgaacttgcaggaattccctatgtagggtgcggtgtacttggttca
gcagttgggatggataaggcctatacaaagataatatttgaaaaggaaggccttccccag
ggagactatcttgtatttaacaggaaacaggtatacaaccggatagaagatgttgttgct
cagatagaaggcagacttacatatccgtgttttgtaaaaccatccaatgccggttcatct
gttggcgtaaacaaggcatctgacagggaaagccttgtaaaggctctaaacatagctgca
aaaaacgacagaaggattcttgttgaggaatttattaatggaagggaaatcgagtgtgct
gttctggggaatgataatccggttgcatcaactgtgggggaagtagttccttgtaatgat
ttctatgattatgaggcaaaataccaagtaggagacagctcaaaagtagttattcctgcc
ccaaacctgtccaaagagaccgtagaaaaaattagggagtatgctgtaagagcgttcaaa
tgccttgattgtgcaggattgtccagagtagacttctttgttcataaagaaacaggagaa
atttacataaatgaaataaacactctcccggggtttacacaaataagtatgtatcctaag
ttgtgggctgcaagcgggatcccctattcagagctgattaataaacttatcgaactggct
tttgaaaggtatgaggacaccagaagagagtatacaaacacgctggactaa

DBGET integrated database retrieval system