KEGG   Ruminiclostridium cellulolyticum: Ccel_2189Help
Entry
Ccel_2189         CDS       T00835                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cce  Ruminiclostridium cellulolyticum
Pathway
cce00040  Pentose and glucuronate interconversions
cce00051  Fructose and mannose metabolism
cce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ccel_2189
   00051 Fructose and mannose metabolism
    Ccel_2189
Enzymes [BR:cce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Ccel_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 Sacchrp_dh_NADP Ldh_1_N TrkA_N DapB_N ThiF Methyltransf_24 DAO
Motif
Other DBs
NCBI-ProteinID: ACL76531
UniProt: B8I4M7
LinkDB All DBs
Position
complement(2562773..2563813)
Genome map
AA seq 346 aa AA seqDB search
MKNRAAYMTEINKMEIRDIEVPKLREKDVLVKLEYVGICGSDVHYLEHGKIGDFIVNGDF
ILGHECAGTVVEVGSGVQDLKVGDKVALEPGITCGQCEFCKTGRYNLCPDVEFLATPPYH
GSLMNYIAFPENMCFKLPDNITTKEGALVEPLAVGMHAANQGEVKLGSSVVILGAGTIGL
VTLLACKANGATDITVVDVIPKRLEYAKNLGATKTINAAEADVFAEIDKLTDKKGVDVVI
ETAGTARTISQTPYMVKNGGNIVLVGLAPQDIIEFNFAKIMAKEATIKSVFRYKNIYPIA
IKAISKGIIDITGIVTHEFNFDDVANAFDYVINNKQDVVKAVIKID
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagagcggcttatatgaccgagataaacaaaatggagataagggacatagag
gttccaaagctccgggaaaaggatgtactcgtaaaacttgaatatgtaggaatttgcggt
tcggatgtacattatcttgagcatggaaaaatcggtgattttatagtaaacggagatttt
atacttggacatgaatgtgccggaactgttgttgaagttggcagtggggtgcaagactta
aaagttggagacaaggttgctttggaaccgggaataacttgcggacaatgcgaattctgt
aaaacaggaagatataacctttgcccggacgttgaatttctggcaacaccgccgtaccac
ggttcactaatgaactatatcgctttccctgaaaatatgtgttttaaattgcctgataac
ataacaacaaaagaaggagcattggttgaacctttggctgttggtatgcacgcagcaaac
cagggagaagtgaagctgggaagttccgttgttatacttggggcaggcacaataggactt
gttactttgcttgcatgtaaagcaaatggagctactgacattactgtagttgacgtaatt
ccaaagagacttgagtatgcaaagaatctgggagcaaccaaaacaataaatgcagcagaa
gccgatgtgttcgcagagatagacaaactcaccgacaaaaaaggcgtggacgttgttata
gaaactgcaggtactgccagaactatttctcagactccgtacatggttaaaaacgggggt
aatattgttcttgtaggtttggcaccacaggacataattgaattcaattttgcaaagatt
atggcaaaggaagctactattaaatccgttttccgttacaaaaacatatatcctatagct
ataaaggctatatcaaaaggtatcatagacataacaggtatagtgacacacgaatttaat
tttgatgatgttgcaaatgcatttgactacgtaataaacaacaagcaggatgttgttaag
gctgttatcaaaatagactga

DBGET integrated database retrieval system