KEGG   Ruminiclostridium cellulolyticum: Ccel_2880Help
Entry
Ccel_2880         CDS       T00835                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cce  Ruminiclostridium cellulolyticum
Pathway
cce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cce01100  Metabolic pathways
cce01110  Biosynthesis of secondary metabolites
cce01130  Biosynthesis of antibiotics
cce01230  Biosynthesis of amino acids
Module
cce_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccel_2880
Enzymes [BR:cce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Ccel_2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB
Motif
Other DBs
NCBI-ProteinID: ACL77174
UniProt: B8I874
LinkDB All DBs
Position
3433865..3434890
Genome map
AA seq 341 aa AA seqDB search
MIIVMNPKSNQMQIDDVINVLKNSGLGVHVSQGTERTIIGIIGDKTVLRDIPLEIMPGVE
KLVPIVESFKLAGKTFRPEPSVVDVNGVKIGGKELVIMAGPCAVESREQVIEAAQAVKRS
GAQFLRGGAFKPRTSPYAFQGLEEEGLKLLKEAKDATGLQIITEVTSDKAVETSIPYVDM
FQIGARNVQNFQLLKEVGKSMKPVLLKRGSATTIDEWLNAAEYIMSEGNYSVVLCERGIR
TFETATRNTLDLSAVPVVKNMSHLPIIVDPSHAAGKSRYVIPLSRAAIAAGADGLIVEVH
PNPMCALSDAAQQLKPSEFDSLCKDISKLAPILEREFNYGC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaatgaatccaaagtcaaatcaaatgcaaattgacgacgtgatcaatgtc
ctgaaaaattcaggtttgggagttcatgtatcacagggtactgaaagaactatcatcggt
attatcggtgataaaacggttcttcgtgacattccacttgaaataatgccgggggttgaa
aaactggttcccattgtagagtccttcaagctggcaggaaagacattccggcctgaaccc
agtgttgtagatgtaaatggcgtaaaaataggcggtaaagaattggttataatggcaggt
ccatgtgccgtagaaagccgggagcaggtaattgaagccgcacaggcagtaaaaaggtcc
ggtgcccagtttttaagagggggtgcttttaagccaagaacctcgccatatgcttttcag
ggccttgaggaagaaggactgaagctgctcaaagaagcaaaggatgcaacaggcttgcag
ataatcacagaagtcaccagtgataaggcagtagaaacatcaataccatatgtggatatg
tttcagataggtgcaagaaatgtgcagaactttcagcttttaaaggaagtaggaaaatcc
atgaaaccagttcttttgaaaagaggttctgcaacaacaattgacgaatggttaaatgct
gccgaatatataatgagtgaaggcaactacagcgtagtattgtgcgaaagaggtatcaga
acctttgaaacagctacaaggaacactcttgatttgagtgcggtccccgtagttaaaaat
atgagccacctccctataatagttgacccaagtcatgctgccggaaagtccaggtatgtt
attcctctttccagggctgcgatagccgcaggtgctgacggtcttatagttgaagttcac
cccaatccaatgtgtgctctctccgatgcagcacagcagctaaagccatccgaatttgat
tcactttgcaaagatataagtaagcttgcaccaattctggagagagagtttaattatgga
tgttag

DBGET integrated database retrieval system