KEGG   Clostridium cellulosi: CCDG5_0658Help
Entry
CCDG5_0658        CDS       T03806                                 

Gene name
ydjJ3
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YdjJ
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ccel  Clostridium cellulosi
Pathway
ccel00040  Pentose and glucuronate interconversions
ccel00051  Fructose and mannose metabolism
ccel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCDG5_0658 (ydjJ3)
   00051 Fructose and mannose metabolism
    CCDG5_0658 (ydjJ3)
Enzymes [BR:ccel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CCDG5_0658 (ydjJ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 2-Hacid_dh_C ThiF DAO
Motif
Other DBs
NCBI-ProteinID: CDZ23787
UniProt: A0A078KMN5
LinkDB All DBs
Position
I:complement(702424..703470)
Genome map
AA seq 348 aa AA seqDB search
MNGKMKVGVLKSTGNIVFEEREIPQIKENEILVKIKHVGICGSDLHYYEYGRIGDFVVEN
PIVLGHESAGEVVAVGEKVADLKIGDLVTLEPGYTCGKCEFCKTGRYNLCPNVVFMATPP
YDGAFAEYVAYPADMAFKLPDGMDTVQGALIEPLAVGIYAAQQGNAGLGQSAAILGSGCI
GLVTLMALKAMGVTRIYVADVIEKRLAKAAELGATKVINAGEQDTVKTIMELTCGKGVDM
VFETAGSKITTLQTAELVKRGGTVVLVGMAPESKLNYDIGKLMGKEASIKTVFRYRNIYP
IAIEAVQNGLIPIDKIVTDTFSFDELPKAIRYSIDNKSDIVKAVIEFK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtaaaatgaaagtcggagttttgaagagcaccggaaatatagtatttgaggaa
agagaaatccctcagatcaaagagaacgaaattctggtaaagataaaacatgtcggcata
tgcggttcggatttacactattatgagtacggaagaatcggcgatttcgttgtagaaaat
ccaatcgtcctcggtcatgagagcgccggtgaagttgtagccgtcggagaaaaggtagct
gatctcaaaatcggtgaccttgtaacgcttgaacccggctatacctgcggtaaatgtgaa
ttctgcaaaaccggcagatataatctctgccccaatgtagtgtttatggcaaccccgcca
tacgacggagcgttcgcggaatatgtcgcgtatcctgccgacatggcgtttaagctgccg
gacggaatggatacggtacagggcgcactcatagagccgctcgcagtaggtatttatgct
gcgcaacagggtaatgccggacttgggcagtcggctgctattcttggctcaggatgtatc
ggcctcgttacactaatggctcttaaagccatgggagtaacacgcatttatgtggccgat
gttattgaaaagcgcctggctaaagccgcagagcttggagcgacaaaagttattaatgcg
ggtgagcaggatacggtgaaaaccattatggaacttacctgcggcaaaggcgttgatatg
gtatttgaaacagcaggcagtaagattaccacattacagactgcagaacttgtgaagcgc
ggcggaactgttgttttggtgggtatggctcccgaatcgaaattgaactatgatatcgga
aaactgatgggcaaagaagcaagtataaaaacagttttcagatatcgtaatatctaccca
attgcaatagaagccgtccagaacgggcttattcccattgacaagattgtaactgatacg
tttagttttgatgagcttccgaaggcgattagatactctatcgataataaatccgatatt
gtaaaggcggtaatcgaatttaaataa

DBGET integrated database retrieval system