KEGG   Clostridium cellulosi: CCDG5_1814Help
Entry
CCDG5_1814        CDS       T03806                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ccel  Clostridium cellulosi
Pathway
ccel00473  D-Alanine metabolism
ccel01100  Metabolic pathways
ccel01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CCDG5_1814 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CCDG5_1814 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccel01011]
    CCDG5_1814 (alr)
Enzymes [BR:ccel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CCDG5_1814 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ccel01011]
 Precursor biosynthesis
  Racemase
   CCDG5_1814 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDZ24912
UniProt: A0A078KR02
LinkDB All DBs
Position
I:complement(1931508..1932689)
Genome map
AA seq 393 aa AA seqDB search
MSCFLKRTWAEVDADCLAHNYHAIRNYIHKDCKLMAIVKADAYGHGAPFVAGEFEALGAD
YFGVSNMEEALQLRGSGIKKPILILGYTPAEYAGEMIAKGITQTVLSLQYAKELSKAAQS
AGGTLKVHIKIDTGMSRIGFLYHDPVKNAGSIDEIMEVSNLPALDLEGIFTHFAVSDEPE
KDFTKIQFERFTDIIQKLGDRGLKFRLRHCCNSAGLLNFPQMQLDMVRPGIILYGMTPAE
GMPLPIELKPVMSLKTIVSQVKTLESGTAVSYGMKYVTDGKKRVATLPVGYADGFARSLS
NKADVLIAGKRARIIGRVCMDQCMADVTDIPEAAENKIVTVIGRDGDNCVTMEELADFMG
TINYETACLIGKRVPRVFLKGGKIVGTQNYILP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctgctttcttaaaagaacttgggctgaggttgacgccgactgtttagcgcacaac
tatcatgccatacggaactacatacataaagactgcaagttgatggctatagtcaaggcc
gacgcctatgggcatggcgcgccgtttgtagccggggaatttgaggcgctcggtgcggat
tatttcggcgtttccaatatggaggaggccttgcagctcaggggcagcggcatcaaaaaa
ccgatactgatacttggctacacccccgccgaatacgccggcgagatgattgcaaaaggc
ataacccagacagtattaagtttgcagtacgcaaaggagctttcaaaggcggctcagagc
gcgggcggtacgctgaaagttcatataaagattgatacaggcatgagccgtataggattt
ctttatcacgaccctgtaaaaaatgccggcagcattgatgagataatggaggtttcaaac
ctgcccgctcttgaccttgagggcatatttacccactttgcggtatccgacgagcctgaa
aaggattttacaaaaatccagttcgaacggtttactgacattatacaaaagcttggcgac
agaggacttaaattccgtttgcgccattgctgcaacagcgcggggcttctcaatttcccg
caaatgcagcttgatatggtgcgcccagggataatactctacggtatgacgcctgctgag
gggatgcccctgccaattgaattaaaaccggtaatgtcacttaaaacgattgtgtcgcag
gtgaaaacccttgagagcggtacagcggtaagctacggcatgaaatatgtaaccgacggc
aaaaaacgtgtggcaacgcttccggtaggatatgccgatgggtttgcccgcagcctatca
aacaaggcagatgttcttatagccggtaagcgcgcgcgtatcatagggcgcgtctgcatg
gaccaatgtatggctgacgttactgatattcctgaagccgccgaaaacaagattgtgacg
gttatcggcagggacggagacaactgcgtgacgatggaggaattagctgattttatgggg
acaatcaactatgaaacggcctgccttatcgggaaacgcgttcctcgtgttttcttaaag
ggcggcaaaatcgtcggcacgcagaattacatactgccttaa

DBGET integrated database retrieval system