KEGG   Cellulosimicrobium cellulans: CBR64_03070Help
Entry
CBR64_03070       CDS       T04858                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00500  Starch and sucrose metabolism
cceu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBR64_03070
Enzymes [BR:cceu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CBR64_03070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 CBM_25 Alpha-amylase Alpha-amylase_C CBM53
Motif
Other DBs
NCBI-ProteinID: ARU50628
UniProt: A0A1Y0HR58
LinkDB All DBs
Position
complement(718545..720752)
Genome map
AA seq 735 aa AA seqDB search
MTRTTDPAGPPAPTPAAAPGARRALGRTVRRDGRPRRVVAAAASAALALGAALAATVPVA
APAAAAPPVPTPVVDSPNGRGDVILNLFQWTWDSVAAECTSTIGPAGFGYVQVSPPQETI
QGTAWWTSYQPVSYRIESKLGTRAEFKNMVDTCRAAGVGVVADAVLNHMAGADQGGGTGV
AGSSYGVENYPGLYGPNDFNDCKENIGNRYGDRYVVQNCRLVSLQDLRTGSEYVRGKIAG
YLNDLLSLGVAGFRIDAAKHIPAADLAAIKGKLTNPNVFWVHEVIGASGEPIQPSEYLGS
GDSHEFFYARDLKSRFDGQIKDLRTIGDNKLPSDRAGVFVDNHDTERNGETMNYTWGAKY
KLANTFMLSWPYGAPSVYSGYTWNDKDAGAPGASATSVPDASCSNSAWVCTQRWTEIAGM
VGFHNAVAGTAVTNWWDDGNNHVAYGRGSKGYVTINNTANAVTRTYQTSLPAGTYCDVVA
SKGCAKTVTVSGSGTFAATVPAYGALALHVGAVDDGGTGGPGPVDPSGTTTVYYATDKGW
NAYNVHYRVGTGAWTAVPGVAMTAACTGWVAKEVALPDGATGAAATVTAAFTNGSGSWDN
NAGKDYSLAGGAVAVSGGTVTAGDPCEGGGEGPGPVEGQGDASFSVTATTTWGQSVLVVG
SIPALGSWVPANGVALSAAGYPVWTATLDLPAGTTFAYKYVKRDGGGNVVWESGGNRTAT
VGQDGSVTLSDTWRS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaccaccgaccccgccggtccgccggcacctacccccgcagcggcgcccggc
gcccgtcgcgctctcgggcgcacggtccggcgcgacggtcgcccgcggcgcgtcgtcgcc
gccgcggcgtcggccgccctcgcgctcggggcggcgctcgccgccacggtcccggtcgcc
gcgcccgccgcggcggcaccgcccgtgccgacgcccgtcgtcgactccccgaacggccgg
ggcgacgtgatcctcaacctcttccagtggacgtgggactccgtggcggccgagtgcacc
agcaccatcggcccggccgggttcggctacgtccaggtctcgccgccgcaggagaccatc
cagggcaccgcgtggtggacctcctaccagcccgtgagctaccggatcgagtcgaagctc
ggcacccgggcggagttcaagaacatggtcgacacctgccgcgccgccggcgtcggcgtc
gtcgccgacgcggtcctcaaccacatggcgggggcggaccagggcggcgggacgggagtc
gcgggctcgtcgtacggcgtcgagaactaccccgggctctacgggccgaacgacttcaac
gactgcaaggagaacatcggcaaccggtacggagaccggtacgtggtgcagaactgccgc
ctcgtctcgctccaggacctgcggacgggctcggagtacgtgcgcggcaagatcgcgggc
tacctcaacgacctgctctccctcggcgtcgccgggttccgcatcgacgccgcgaagcac
atcccggccgccgacctcgcggcgatcaaggggaagctcacgaacccgaacgtcttctgg
gtgcacgaggtcatcggcgcgagcggtgagccgatccagccctcggagtacctcggctcc
ggggactcgcacgagttcttctacgcgcgcgacctcaagtcccggttcgacggccagatc
aaggacctgcgcaccatcggcgacaacaagctcccgtcggaccgcgcgggcgtgttcgtc
gacaaccacgacaccgagcgcaacggcgagaccatgaactacacgtggggcgccaagtac
aagctcgcgaacacgttcatgctctcgtggccctacggcgcgccgagcgtctactcgggc
tacacgtggaacgacaaggacgccggtgcccccggcgcgtccgcgacgtccgtgccggac
gcgagctgctcgaacagcgcgtgggtctgcacgcagcgctggaccgagatcgcgggcatg
gtcggcttccacaacgccgtcgccgggaccgcggtgacgaactggtgggacgacgggaac
aaccacgtcgcgtacggccgcggcagcaaggggtacgtgacgatcaacaacaccgcgaac
gccgtcacgcgcacctaccagacgtcgctcccggcgggcacgtactgcgacgtcgtcgcg
tcgaagggctgcgccaagacggtcacggtctccggctccggtaccttcgccgcgacggtc
cccgcctacggggcgctcgccctgcacgtcggcgccgtggacgacggcggcaccggcggc
cccggtcccgtcgacccgagcggcacgacgaccgtctactacgcgaccgacaagggctgg
aacgcgtacaacgtccactaccgcgtcggcacgggtgcctggaccgccgtgcccggcgtc
gcgatgaccgcggcctgcaccggctgggtcgcgaaggaggtcgccctgccggacggcgcg
accggcgccgccgcgacggtcacggcggcgttcaccaacggctccggctcctgggacaac
aacgccggcaaggactattccctggccggcggggccgtcgcggtctcgggtgggaccgtc
acggcgggcgacccgtgcgagggcggcggcgagggccccggtcccgtcgagggtcagggt
gacgcgtcgttctccgtgacggcgacgacgacgtgggggcagagcgtgctcgtcgtcggg
agcatccccgcgctggggtcctgggtgcccgcgaacggcgtcgcgctctccgccgcgggc
taccccgtctggaccgcgaccctcgacctgccggccgggacgacgttcgcgtacaagtac
gtcaagcgcgacggcggcgggaacgtcgtctgggagagcggcggcaaccgcacggcgacg
gtcggccaggacggctctgtgacgctgtcggacacctggaggtcgtga

DBGET integrated database retrieval system