KEGG   Cellulosimicrobium cellulans: CBR64_06200Help
Entry
CBR64_06200       CDS       T04858                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00520  Amino sugar and nucleotide sugar metabolism
cceu01100  Metabolic pathways
cceu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBR64_06200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CBR64_06200
Enzymes [BR:cceu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CBR64_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ARU51143
UniProt: A0A1Y0HVG7
LinkDB All DBs
Position
1454076..1455359
Genome map
AA seq 427 aa AA seqDB search
MSRRSGFRASSGAGLRWPLEVPPLTPRARTTWIVVAVVTTLAAVSAVAWYLTRPGPTPAP
SPSGAPTASPDPSPSGPPPTPSTPPEDPLAGWTLEQKVGQLFMVGVDVSDPQQVSYDAVS
QLHVGNVFLAGRSQAGTGPTADLVAGFTALVSADTTNGTPLFVATDQEGGYVQVLRGPGF
SQIPTATDQAALDPATLQADATTWGGELAAAGVNLNLAPVMDLVPEGTAAQNPPIGYFQR
NYGFTPDLVTTHANAFSAGMEASGVDVTIKHFPGLGRVTENTDTDAGVTDDVTTRDDPSV
AVFASGIEAGAAFVMTSTAVYAQIDGSLPAAFSPVVVDGMLRGDLGYDGVVITDDVSAAQ
QVQAWSPADRAVLTIDAGGDMVLASADPGVVQPMVAAVVERATTDPAFAAKVDAAVVRVL
AAKQRLG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgccgctccgggttccgcgcgtcgagcggcgccgggctacggtggccgctggag
gtgccgcccttgaccccccgtgcccggaccacctggatcgtcgtcgccgtcgtcaccacg
ctcgccgccgtctcggcggtcgcgtggtacctcacccgcccgggccccaccccggccccg
tcgccctcgggcgcgccgaccgcctcccccgacccgtcgccgtcgggccctcccccgacg
ccgtccaccccgcccgaggacccgctggccgggtggacgctcgagcagaaggtcgggcag
ctcttcatggtcggcgtcgacgtgagcgacccgcagcaggtgagctacgacgcggtgtcg
cagctccacgtcggcaacgtgttcctcgccgggcgctcgcaggcgggcaccggcccgacg
gcggacctcgtcgcgggcttcacggcgctcgtctcggcggacacgaccaacggcacgccg
ctgttcgtcgcgaccgaccaggagggcgggtacgtccaggtgctgcgcgggcccgggttc
tcgcagatccccacggccacggaccaggcggcgctcgacccggcgacgctccaggccgac
gcgacgacgtggggcggcgagctcgcggcggccggggtgaacctcaacctcgcgccggtg
atggacctcgtgcccgaggggacggcggcgcagaacccgccgatcgggtactttcagcgg
aactacggcttcacgccggacttggtgacgacccacgcgaacgcgttcagcgccggcatg
gaggcgtccggggtcgacgtgacgatcaagcacttcccggggctgggccgcgtcaccgag
aacacggacaccgacgcgggcgtcacggacgacgtgacgacgcgcgacgacccgtccgtc
gcggtcttcgcgtcggggatcgaggcgggcgccgcgttcgtcatgacgtccaccgccgtc
tacgcgcagatcgacggctcgctgcccgcggcgttctcgcccgtcgtcgtcgacgggatg
ctgcgcggcgacctggggtacgacggcgtcgtcatcacggacgacgtgtctgcggcgcag
caggtgcaggcgtggtcgcccgccgaccgcgccgtcctgacgatcgacgcgggcggcgac
atggtgctcgcgtccgccgacccgggcgtcgtgcagcccatggtggcggccgtcgtcgag
cgcgcgacgaccgacccggcgttcgcggcgaaggtggacgccgccgtcgtgcgggtcctc
gcggcgaagcagcggctgggctga

DBGET integrated database retrieval system