KEGG   Cellulosimicrobium cellulans: CBR64_08420Help
Entry
CBR64_08420       CDS       T04858                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00250  Alanine, aspartate and glutamate metabolism
cceu00410  beta-Alanine metabolism
cceu00430  Taurine and hypotaurine metabolism
cceu00650  Butanoate metabolism
cceu01100  Metabolic pathways
cceu01110  Biosynthesis of secondary metabolites
cceu01120  Microbial metabolism in diverse environments
cceu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBR64_08420
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBR64_08420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBR64_08420
   00430 Taurine and hypotaurine metabolism
    CBR64_08420
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBR64_08420
Enzymes [BR:cceu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CBR64_08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ARU51500
UniProt: A0A1Y0HU40
LinkDB All DBs
Position
1959477..1960847
Genome map
AA seq 456 aa AA seqDB search
MTDEQHVLRPTYTRPGVRAVAPRFTMPDAEMEPTSAYQVVHDEVMLDGNSRLNLATFVAT
WMGDEADRLYAEVYDKNMVDKDEYPRTAAVEENCWRILGSLWNVPDVQDCIGTSTIGSSE
ACMLGGLALKRRWQLARRAAGKPADRPNLIMSSAVQVCWEKFCNYFEVEARYVPISEEHP
CLDGSDLEKYVDENTIGVVAIMGVTYTGMYEPVKEIAAALDALQERTGLDVPIHVDGASG
AMIAPFLQPEIEWDFRLERVHSISTSGHKYGLVYPGVGWVVWRTLDALPEELVFRVSYLG
GNMPTLALNFSRPGAQVLLQYFQFLRLGREGYTAIQQECQDVAKYLAHGIEDIGAFDLWN
DGSDIPVFAWRLKPGHTENWDLYHLSDRLRMKGWLVPAYPMPDDLADLTVQRIVVRNGVS
RDLADDLLEDIRVETEWLDGLTSPMPAEGKRSGFHH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagcagcacgtcctgcgcccgacctacacccgacccggcgtgcgggcggtc
gcgccacgcttcaccatgccggacgcggagatggagccgacgtccgcctaccaggtcgtc
cacgacgaggtgatgctcgacggcaactcgcgcctcaacctcgcgacgttcgtcgcgacg
tggatgggcgacgaggcggaccgtctctacgccgaggtctacgacaagaacatggtcgac
aaggacgagtacccgcgcacggcggcggtcgaggagaactgctggcgcatcctcgggtcg
ttgtggaacgtgccggacgtgcaggactgcatcggcacgtcgacgatcgggtcgtctgag
gcgtgcatgctcgggggcctcgcgctcaagcggcgctggcagctcgcgcggcgggcggcg
ggcaagccggcggaccggccgaacctcatcatgagctcggccgtgcaggtgtgctgggag
aagttctgcaactacttcgaggtggaggcgcggtacgtgccgatctcggaggagcacccg
tgcctcgacggcagcgacctcgagaagtacgtcgacgagaacacgatcggtgtcgtcgcc
atcatgggcgtgacgtacacgggcatgtacgagcccgtgaaggagatcgcggccgcgctc
gacgcgctccaggagcgcaccggcctcgacgtcccgatccacgtcgacggcgcgtccggc
gccatgatcgcgccgttcctccagccggagatcgagtgggacttccgcctggagcgcgtg
cactcgatcagcacgtcggggcacaagtacgggctcgtgtaccccggggtcggctgggtc
gtgtggcgcacgctcgacgcgctgcccgaggagctggtcttccgggtgagctacctcggc
gggaacatgccgacgctcgccctcaacttctcgcgcccgggcgcccaggtgctgctccag
tacttccagttcctgcggctgggccgggagggctacaccgcgatccagcaggagtgccag
gacgtcgccaagtacctcgcgcacgggatcgaggacatcggcgcgttcgacctgtggaac
gacgggtcggacatcccggtcttcgcgtggcggctcaagccgggccacacggagaactgg
gacctctaccacctctcggaccggctgcgcatgaagggctggctggtccccgcctacccg
atgccggacgacctcgccgacctcaccgtgcagcggatcgtcgtgcgcaacggcgtgagc
cgcgacctcgccgacgacctcctggaggacatccgcgtcgagacggagtggctcgacggg
ctcacgtcgcccatgcccgccgagggcaagcgctcgggcttccaccactga

DBGET integrated database retrieval system