KEGG   Cellulosimicrobium cellulans: CBR64_10325Help
Entry
CBR64_10325       CDS       T04858                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00630  Glyoxylate and dicarboxylate metabolism
cceu01100  Metabolic pathways
cceu01110  Biosynthesis of secondary metabolites
cceu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CBR64_10325
Enzymes [BR:cceu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     CBR64_10325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ARU51825
UniProt: A0A1Y0HX08
LinkDB All DBs
Position
2390122..2390799
Genome map
AA seq 225 aa AA seqDB search
MSVRDDLVLLDLDGTLTDSAPGILASVRHAYGVLRLPVPADPVLRGFVGPPLGESFAAHG
VPRDLVADAVAAYRDVYTAGNLLDNAVYPGIPECLTALRGAGLRLAVATSKPEPMARRIV
AHFGLDAYLDRGLDDVFGATLDGSRSTKADVVAHALASLDAARRVVMVGDREHDVLGAAA
HGVPCVGVAWGYARPGELAAAGATAVVGTPAELATVLLHRAPLAG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcgcgacgacctcgtcctcctcgacctcgacggcacgctcacggactcggcc
cccgggatcctcgcgtcggtgcggcacgcgtacggcgtgctgcggctccccgtcccagcc
gacccggtgctccgcggcttcgtcggtccgccgctcggggagtcgttcgcggcgcacggc
gtcccgcgcgacctcgtggccgacgccgtcgccgcctaccgcgacgtgtacacggcgggg
aacctcctcgacaacgcggtctaccccggcatccccgagtgcctgacggcgctgcgcggg
gccgggctgcgcctcgccgtggcgacctcgaagccggagccgatggcgcggcggatcgtc
gcccacttcgggctcgacgcgtacctcgaccgcggcctcgacgacgtgttcggcgcgacg
ctcgacggctcgcgcagcaccaaggccgacgtcgtcgcgcacgcgctcgcgtcgctcgac
gcggcccggcgcgtggtcatggtcggcgaccgcgagcacgacgtcctcggcgccgccgct
catggggtcccgtgcgtcggggtcgcgtggggctacgcccgcccgggcgagctggccgcg
gcgggggcgacggcggtcgtcgggacgcccgccgagctcgcgaccgtcctgctccaccgg
gcgccgctcgcgggctga

DBGET integrated database retrieval system