KEGG   Cellulosimicrobium cellulans: CBR64_12445Help
Entry
CBR64_12445       CDS       T04858                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CBR64_12445
Enzymes [BR:cceu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CBR64_12445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Glyco_hydro_1 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ARU52155
UniProt: A0A1Y0HXX1
LinkDB All DBs
Position
complement(2896662..2898806)
Genome map
AA seq 714 aa AA seqDB search
MSTPTPFRWLRRPGPHTPPGTTAAAVGATDAYAPSGLSYGADYNPDQWPREVWDEDVRLM
REAGVTVVSLAIFSWARIQPTEHTWDFAWLDEIMDLLHANGITVDLATATASPPPWLTTK
HPEILPQTRTGETLWPGARQQWRPTSPIFRSHALHLVERMAERYGDHPALVAWHVSNELG
CHNVDDFSDDAAAAFRAWLRERYTTLDALNDAWGTAFWSQRYSAWEQILPPRLAASHPNP
TQQLDFKRFSSDALRQHLRAEAEILRRITPDVPVTTNFMVMGETKGMDYAAWADELDFVS
NDHYVLPGPQALDELSFSANLTGGIARHQPWFLMEHSTSAVNWQPVNVAKKPGELARDSL
THVAHGADAVCYFQWRQSAAGAEKYHSGMLPHAGERSRLFRDVVALGATLRDLAPVAGSE
QKPARAAIVFDWDSWWTSELDSHPTDRLRYRQEALDWYSAFLALGVRADVVPTATDLAGY
DVVVAPVLHVVPADLRDRLTAFVEGGGHLVTTYFSGVVDQDDHAWLGGYPGALRDLLGIR
VEEFAPLLDGESATVELAGEQLEGTLWTEPVDVVDPDVEVLGWYKTGEQSGRAAVTRRTV
RSGENSGSAAYVSTRFGRLGLVPVLARLLDDAGVRSELPAVVRGDVELAVRTDGTDDFWF
LVNRTARPLEVPDVAGEVLAGRRLGPSGAADGVLLLEPRGVAVVRRPAEPTSPR
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccccaccccgttccgctggctgcgccgtcccgggccgcacacgccgccgggc
acgacggctgcggccgtcggagcgaccgacgcgtacgcgccgtcgggcctgtcctacggc
gcggactacaacccggaccagtggccgcgcgaggtctgggacgaggacgtgcgcctcatg
cgcgaggcgggcgtgacggtggtctcgctcgcgatcttctcgtgggcgcggatccagccg
acggagcacacgtgggacttcgcgtggctcgacgagatcatggacctgctccacgcgaac
ggcatcacggtcgacctcgcgacggcgacggcctcgccgccgccgtggctcacgacgaag
cacccggagatcctgccgcagacgcgcacgggcgagacgctgtggcccggcgcgcgccag
cagtggcgcccgacgtcgccgatcttccggtcgcacgcgctgcacctcgtggagcgcatg
gccgagcggtacggcgaccacccggcgctcgtcgcctggcacgtctccaacgagctgggc
tgccacaacgtcgacgacttctccgacgacgccgccgcggcgttccgcgcgtggctgcgc
gagcgctacacgaccctcgacgcgctgaacgacgcgtggggcacggcgttctggtcgcag
cggtacagcgcgtgggagcagatcctgccgccgcggctggccgcgtcgcacccgaacccg
acgcagcagctcgacttcaagcgcttctcgtccgacgcgctgcggcagcacttgcgcgcg
gaggccgagatcctgcggcgcatcacgccggacgtccccgtgacgaccaacttcatggtc
atgggcgagacgaagggcatggactacgccgcctgggcggacgagctcgacttcgtctcc
aacgaccactacgtgctccccggaccgcaggccctggacgagctgtcgttctccgcgaac
ctcacgggcggcatcgcgcggcaccagccgtggttcctcatggagcactcgacgagcgcg
gtgaactggcagcccgtcaacgtcgcgaagaagccgggcgagctcgcccgcgactcgctc
acgcacgtcgcgcacggcgccgacgcggtctgctacttccagtggcgccagtccgcggcg
ggcgccgagaagtaccactcgggcatgctcccgcacgcgggcgagcgctcgcggctcttc
cgcgacgtcgtcgcgctcggcgcgacgctgcgcgacctagcgcccgtcgcgggcagcgag
cagaagcccgcgcgcgccgcgatcgtcttcgactgggactcgtggtggacgagcgagctc
gactcccaccccacggaccggctgcgctaccggcaggaggcgctcgactggtactcggcg
ttcctcgcgctcggcgtgcgcgccgacgtcgtgccgacggccacggacctcgcggggtac
gacgtcgtcgtggcgcccgtcctgcacgtcgtcccggccgacctgcgcgaccgcctcacg
gcgttcgtcgagggcggcggccacctcgtgacgacgtacttctcgggcgtcgtcgaccag
gacgaccacgcgtggctcggcggctacccgggcgcgctgcgcgacctgctcggcatccgc
gtcgaggagttcgccccgctgctggacggcgagagcgcgacggtcgagctcgcgggcgag
cagctcgaggggacgctgtggaccgagccggtcgacgtcgtcgacccggacgtcgaggtg
ctgggctggtacaagaccggcgagcagtccgggcgcgccgcggtgacgcgccgcacggtc
cggtccggcgagaactccggctccgcggcgtacgtctccacgcggttcggccgcctcggc
ctcgtccccgtgctcgcccgcctgctcgacgacgcgggcgtgcgcagcgagctgcccgcc
gtcgtgcgcggcgacgtcgagctcgcggtgcgcaccgacggcacggacgacttctggttc
ctcgtcaaccgcaccgcccgtccgctcgaggtgcccgacgtcgcgggcgaggtcctcgcg
ggccgccgcctcgggccgtcgggcgcggcggacggcgtgctcctgctcgagccgcgcggc
gtcgccgtcgtacgccgcccggccgagccgacctcgccgaggtag

DBGET integrated database retrieval system