KEGG   Cellulosimicrobium cellulans: CBR64_14170Help
Entry
CBR64_14170       CDS       T04858                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu00020  Citrate cycle (TCA cycle)
cceu00480  Glutathione metabolism
cceu01100  Metabolic pathways
cceu01110  Biosynthesis of secondary metabolites
cceu01120  Microbial metabolism in diverse environments
cceu01130  Biosynthesis of antibiotics
cceu01200  Carbon metabolism
cceu01210  2-Oxocarboxylic acid metabolism
cceu01230  Biosynthesis of amino acids
Module
cceu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cceu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cceu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBR64_14170
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CBR64_14170
Enzymes [BR:cceu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBR64_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh NTP_transf_6
Motif
Other DBs
NCBI-ProteinID: ARU52431
UniProt: A0A1Y0HWA5
LinkDB All DBs
Position
3300927..3302144
Genome map
AA seq 405 aa AA seqDB search
MGKIKVVNPVVELDGDEMTRIIWQFIKDRLIHPYLDVDLKYYDLSIQNRDATDDQVTVDA
ANAIKQYNVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKSTNFKVPGPGKITMTFEPADGSEPQKFEVVTMPEEGGVAM
GMYNFNESIRDFARASFAYGLQREYPVYLSTKNTILKAYDGAFKDIFQEVFDAEFAEAFA
AKGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
QTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLMHRGKLDGTPEVTEFAQTLE
DVVIKTVEAGQMTKDLALLVGPDQEWLTTEDFLAALDENLKARLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtcgtcaacccggtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggaccgcctcatccacccgtacctcgacgtggacctcaag
tactacgacctgtcgatccagaaccgcgacgcgacggacgaccaggtcaccgtggacgcg
gcgaacgcgatcaagcagtacaacgtgggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctcggtggcgtcgtcttccgcgagcccatcatcatctcgaacatcccgcgcctc
gtgccgggctggaacaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
tcgacgaacttcaaggtccccggccccggcaagatcacgatgacgttcgagccggccgac
ggctccgagccgcagaagttcgaggtcgtgaccatgcccgaggagggcggcgtcgcgatg
ggcatgtacaacttcaacgagtcgatccgcgacttcgcgcgcgcctcgttcgcgtacggc
ctccagcgcgagtaccccgtgtacctctcgacgaagaacacgatcctcaaggcctacgac
ggcgccttcaaggacatcttccaggaggtgttcgacgccgagttcgccgaggcgttcgcc
gcgaagggcctcacctacgagcaccgcctcatcgacgacatggttgcctcggccatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggcttcggctcgctcggcctcatgacgtcggtcctcatgaccccggacggc
cagaccgtcgaggccgaggccgcgcacggcaccgtgacccgtcactaccgccagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggacccgcggcctc
atgcaccgcggcaagctggacggcacgcccgaggtcaccgagttcgcgcagaccctcgag
gacgtcgtcatcaagaccgtcgaggccggccagatgacgaaggacctcgcgctcctcgtc
ggcccggaccaggagtggctgacgaccgaggacttcctcgccgcgctcgacgagaacctc
aaggcgcgactgggctga

DBGET integrated database retrieval system