KEGG   Cellulosimicrobium cellulans: CBR64_18035Help
Entry
CBR64_18035       CDS       T04858                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
cceu  Cellulosimicrobium cellulans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase FANC_SAP
Motif
Other DBs
NCBI-ProteinID: ARU53052
UniProt: A0A1Y0HXZ9
LinkDB All DBs
Position
4172204..4173310
Genome map
AA seq 368 aa AA seqDB search
MDLPVMPPVLPMLAKSVPDVPEPDAVEGGYVYEPKWDGFRAIVYRDGDEVRLDSRNARPM
ERYFPEVVEAVREALPPRCVVDGEIVVARDGRLEFEVLQQRIHPAASRVRLLAEQTPAAL
VVFDVLALGDDDLTGEPLARRHEVLDSLGLDGPAVHATPRTRDVAVAREWFDTFEGAGLD
GVVAKPLDGTYQPNKRAMLKIKHGREADVVLAGYRLHKTSTPAKPLLGSLLLGLYDDGGQ
LQFVGVAASFPAARRAALVAELAPLVVEPGTPEADAHPWSGWENPAGERMPGAVSRWSSG
KDLSFTPLRVERVLEVSYDHMEGTRFRHTAQFRRWRDDRDPSSCTYDQLEEPVRYDLTGI
LPGAPGVA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctcccgtactgcccatgctcgcgaagtccgtgcccgacgtg
cccgagcccgacgccgtggagggtgggtacgtctacgagcccaagtgggacgggttccgc
gcgatcgtgtaccgcgacggcgacgaggtgcgcctcgacagccggaacgcgcgcccgatg
gagcgctacttcccggaggtcgtcgaggcggtgcgcgaggccctgccgccccgctgcgtc
gtcgacggcgagatcgtcgtcgcccgggacgggcgcctcgagttcgaggtgctgcagcag
cgcatccaccccgcggcctcgcgcgtgcgcctgctcgccgagcagacgcccgccgcgctc
gtcgtgttcgacgtgctcgcgctcggtgacgacgacctcacgggcgagccgctggcacgc
cgtcacgaggtgctggactcgctcggcctcgacggccccgccgtgcacgccaccccccgt
acccgtgacgtcgcggtcgcgcgcgagtggttcgacaccttcgagggtgcggggctcgac
ggcgtcgtcgcgaagccgctcgacgggacctaccagcccaacaagcgcgcgatgctcaag
atcaagcacgggcgcgaggcggacgtcgtgctcgcggggtaccggctgcacaagacgtcg
acgcccgcgaagccgctgctcgggtcgctcctgctcgggctgtacgacgacggcggccag
ctccagttcgtgggtgtcgccgcgtccttcccggcggcgcgccgggccgcgctcgtggcc
gagctcgccccgctggtcgtcgagccgggcacgccggaggccgatgcgcacccctggtcc
ggctgggagaaccccgcgggcgagcggatgccgggcgccgtgtcgcggtggagctccggc
aaggacctctccttcacgccgctgcgcgtcgagcgcgtgctcgaggtgtcgtacgaccac
atggagggcacgcggttccggcacacggcgcagttccggcgctggcgcgacgaccgggac
ccgtcgtcgtgcacgtacgaccagctcgaggagccggtgcgctacgacctgacgggcatc
ctcccgggtgcgcccggcgtggcctag

DBGET integrated database retrieval system