KEGG   Cellulosimicrobium cellulans: CBR64_18505Help
Entry
CBR64_18505       CDS       T04858                                 

Definition
(GenBank) dolichol-phosphate mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cceu  Cellulosimicrobium cellulans
Pathway
cceu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cceu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cceu01003]
    CBR64_18505
Enzymes [BR:cceu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     CBR64_18505
Glycosyltransferases [BR:cceu01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   CBR64_18505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: ARU53132
UniProt: A0A1Y0HY77
LinkDB All DBs
Position
complement(4271132..4271944)
Genome map
AA seq 270 aa AA seqDB search
MSERRGEPAAPGRVLVVVPTYDEALTLPGTLARLRAAVPDADVLVVDDASPDGTGELADA
AAATDPGVHVLHRAGKEGLGAAYVAGFGWGLDAGYDVLVEMDADGSHRPEQLPSLLAALD
AAGETGDGAGADLVIGSRWVPGGQVENWPWHREVLSRAGNVYVRLALGLGLGDATAGFRA
YRADALRAVDLASVESHGYCFQVDMAWRVERAGGRVVEVPITFVERTAGRSKMSRAIVTE
ALWKVTVWGARRRAAQLSAVVRGRGSRASG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcgccgcggggagcccgccgcgccgggccgcgtgctcgtcgtcgtgcccacg
tacgacgaggcgctgaccctgccgggcacgctcgcgcggctgcgcgcggcggtgccggac
gcggacgtgctcgtcgtggacgacgcgagccccgacgggacgggtgagctcgccgacgcc
gcggccgccacggacccgggcgtgcacgtgctgcaccgcgcgggcaaggagggcctgggc
gccgcgtacgtcgcggggttcggctggggcctggacgccgggtacgacgtcctggtcgag
atggacgccgacgggtcgcaccggcccgagcagctgccgtccctgctcgccgcgctcgac
gcggcgggggagaccggcgacggcgcgggcgcggacctcgtgatcgggtcgcgctgggtg
ccgggcgggcaggtggagaactggccgtggcaccgcgaggtgctctcccgtgccgggaac
gtgtacgtgcggctcgcgctcgggctcggcctgggtgacgcgacggcgggcttccgcgcg
taccgcgccgacgcgctgcgcgccgtcgacctcgcgagcgtggagtcgcacggctactgc
ttccaggtcgacatggcctggcgggtcgagcgcgcgggcgggcgggtggtcgaggtgccg
atcacgttcgtcgagcgcacggcgggccggtcgaagatgagccgcgcgatcgtcaccgag
gcgctgtggaaggtcacggtgtggggtgcacgacgccgcgcggcccagctgtccgccgtc
gtgcgggggcgggggagccgcgcctcgggctga

DBGET integrated database retrieval system