KEGG   Campylobacter coli RM1875: YSQ_00990Help
Entry
YSQ_00990         CDS       T03164                                 

Definition
(GenBank) peptide ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ccf  Campylobacter coli RM1875
Pathway
ccf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ccf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YSQ_00990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccf02000]
    YSQ_00990
Transporters [BR:ccf02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    YSQ_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA TniB AAA_16 RNA_helicase Terminase_1 DUF3652 AAA_24 AAA_5
Motif
Other DBs
NCBI-ProteinID: AHK72579
LinkDB All DBs
Position
198464..199087
Genome map
AA seq 207 aa AA seqDB search
MIVGESGVGKSLLGKSLIRLLDPKFEINADEWSFNEVSVFNLNQNELRAFRSKVGLVLQD
AELSLYPYLNIGNLFHLILKTHTKLNQKDRKRYAFDLLEKLGFDDVDLLWHSYANELSLG
MARRVSLALALLSKPQILICDEITASLDKENVQKIIQILKKLKNTLGLVCITHDLNLVNS
LADEVLFLEKNQAQLFRVDEFLRIYHA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgggtgagagtggggttggaaaaagtcttttgggaaaatccttaatcagactg
cttgatcctaaatttgaaatcaacgcagatgaatggagctttaatgaagtttctgttttc
aatttaaatcaaaacgaacttcgtgcatttcgttctaaagtcggacttgttttacaagat
gcagagcttagcctttatccgtatttgaatataggaaatttatttcatcttattttaaaa
actcatacaaaattaaatcaaaaggaccgtaaaagatatgcttttgatttgcttgaaaaa
ttaggctttgatgatgtagatttattgtggcattcttatgcaaatgaattaagtttgggt
atggcaagaagagtgagtttagctctagctttattaagcaagcctcaaattttaatttgc
gatgagattacagcttctttagataaagaaaatgtgcaaaaaatcattcaaatattaaaa
aaattaaaaaatactttaggcttagtttgtatcacacatgatttaaatttagtcaattct
ttagcagatgaggtgctttttttagaaaaaaatcaagcgcaactttttagagtggatgaa
tttttaaggatttatcatgcttga

DBGET integrated database retrieval system