KEGG   Campylobacter coli RM1875: YSQ_05410Help
Entry
YSQ_05410         CDS       T03164                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccf  Campylobacter coli RM1875
Pathway
ccf00473  D-Alanine metabolism
ccf00550  Peptidoglycan biosynthesis
ccf01100  Metabolic pathways
ccf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YSQ_05410
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YSQ_05410
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    YSQ_05410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccf01011]
    YSQ_05410
Enzymes [BR:ccf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YSQ_05410
Peptidoglycan biosynthesis and degradation proteins [BR:ccf01011]
 Precursor biosynthesis
  Amino acid ligase
   YSQ_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 RAMPs
Motif
Other DBs
NCBI-ProteinID: AHK73400
LinkDB All DBs
Position
1030859..1031899
Genome map
AA seq 346 aa AA seqDB search
MKLAILFGGNSYEHEISIVSAVVLKKVINTDLTFIFCDEKRRFYLIPSEKMNSKTFSGGA
YQKEKELFLRQKAFYHKSLWSEKNLDLDCVINLIHGRDGEDGKIASLLEFFDIKFIGPRV
EASVLSFNKEFTKLYAQSVGVKTLDYQMLRKSQKQDFTAHFPCILKPARLGSSIGISIAK
NEKELDYAKDVGFEFDTDILVEDFKSNIKEYNLAGCMIKDEFIFSIIEEPKKKEFLDFEQ
KYLSFSGHNELIEADLSEELKQKLKDNFAKIYNPLFKGALIRCDFFILDNEVYLNEINPN
PGSLANYLFKDFNKIIEQLALSIESEKKIKITYEFLHSINGQKGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcgatactttttggcggaaattcttacgaacatgaaatcagcattgtaagt
gctgtggtattaaaaaaagtgataaatacggatttgacatttattttttgcgatgaaaaa
aggagattttatttaattcctagcgaaaaaatgaattctaaaacctttagcggtggtgct
taccaaaaagaaaaggagttatttttaagacaaaaggctttttatcataaaagtctatgg
agtgaaaaaaacttagatttagattgtgtgatcaacctcatccacggaagagatggagaa
gacggaaagatagcttctttgcttgaattttttgatatcaaattcataggtcctagggtt
gaagcaagtgttttatctttcaataaagagttcacaaaactttacgcacaaagcgttggg
gttaaaactctagattatcaaatgcttagaaaaagtcaaaagcaagattttacagctcat
tttccttgcattttaaagcctgcacgacttgggagcagtatagggattagcatagctaaa
aatgaaaaggaattggattatgctaaggatgtgggttttgagtttgatactgatattttg
gtagaggattttaaaagtaacatcaaagagtacaatcttgcaggatgtatgatcaaagat
gaatttatcttttcaatcatcgaagaaccaaagaaaaaagaatttttggattttgagcaa
aaatatcttagtttttcaggccataacgaacttatcgaagctgatttgagcgaagaatta
aagcaaaagcttaaagataattttgccaaaatttataatcctttatttaaaggtgcttta
atccgttgtgattttttcatcctagataatgaagtttatctgaatgaaatcaatccaaat
ccaggctctttagcaaattatcttttcaaagattttaacaaaattatagagcaacttgct
ctaagtatagaaagcgaaaagaagattaaaatcacttatgaatttttacattctattaat
ggacaaaaaggcaaattataa

DBGET integrated database retrieval system