KEGG   Corynebacterium casei: CCASEI_02095Help
Entry
CCASEI_02095      CDS       T03041                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccg  Corynebacterium casei
Pathway
ccg00020  Citrate cycle (TCA cycle)
ccg00190  Oxidative phosphorylation
ccg00650  Butanoate metabolism
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01130  Biosynthesis of antibiotics
ccg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCASEI_02095 (sdhA)
   00650 Butanoate metabolism
    CCASEI_02095 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCASEI_02095 (sdhA)
Enzymes [BR:ccg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCASEI_02095 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CCASEI_02095 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: AHI19004
UniProt: W5XQU3
LinkDB All DBs
Position
422516..424531
Genome map
AA seq 671 aa AA seqDB search
MTNTELLREHPNFSHPKSIVDGVSAGNILESHEPHGVPMKDMWNYHKDHMDLVSPLNRRK
FTVLVAGTGLSAGAAAAALGELGYNVKVFTYHDSPRRAHSIAAQGGVNSSRSKKVDNDSA
YRHAKDTVKGGDYRCRESDCWRLAMESPRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSTTSALYRQLGLGNVELFAHHDMQDVITYDNEGKNRAGGIVTRNL
ITGELKAFTGNAVILGTGGYGNVYHMSTLAKNSNAGALMRAYEQGAYFASPAFIQFHPTG
LPVNSSWQSKTILMSESLRNDGRIWSPKTEGDDRDPNSIPDDERDYFLERRYPAFGNLVP
RDVASRAISQQINAGYGVGPLKNSVYLDFRDAIQRLGKDTIRERYSNLIEMYEEAIGESA
YESPMRIAPTCHFTMGGLWTDFNEMTSIEGLFATGEASWTYHGANRLGANSLLSASVDGW
FTLPFTVPHFLAKHLGEEKLAEDSAEAKVAVERAQARIDRLMNIRGENPHGPAYYHRQLG
EILYWGCGVSRNIEDLKTSIEKIRELRKDFWANVRIPGSADDMNQVLEYGARVADYIDLG
ELMCIDALDRDESCGAHFRDDHLSEDGEAERDDENWCFVSAWEPGETEGEFIRHAEPLYF
DSIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgactaacactgaactgttgcgagagcacccgaacttctcgcaccctaagtccatcgtt
gacggtgtctctgcaggtaacatcctggaatctcacgaacctcacggtgtgcctatgaag
gatatgtggaactaccacaaggaccacatggaccttgtgtctccacttaaccgccgtaag
ttcaccgttctggttgccggcactggcctgtccgctggtgcagctgcggcagcactcggc
gagctgggctacaacgttaaggtcttcacctaccatgactccccacgtcgtgcgcactcc
attgctgcacagggtggtgtgaactcttcacgttccaagaaggttgacaacgactccgct
tatcgccatgcaaaggataccgtcaagggcggcgactaccgttgccgtgagtccgattgc
tggcgtttggcgatggaatccccacgcgttatcgaccacatgaacgctattggtgcaccg
ttcgcccgtgagtacggcggcaccctggcaacgcgttccttcggcggtgtgcaggtctcc
cgtacctactacacccgtggacaaaccggtcagcagctgcagctgtccaccacttctgcg
ctttaccgccagctgggcctgggcaacgtggagctttttgctcaccacgatatgcaggac
gttattacctacgacaacgaaggtaagaaccgtgcaggcggcattgttacccgtaacctg
atcactggtgagctcaaggctttcaccggtaacgcagttatcttgggtaccggtggctac
ggcaacgtttaccacatgtccaccttggcgaagaactcgaacgccggcgctttgatgcgt
gcctacgagcagggtgcatactttgcttccccagcattcatccagttccacccaaccggt
cttccagtgaactcttcctggcagtctaagaccattttgatgtcggagtcgctgcgcaat
gacggccgcatctggtctcctaagaccgaaggtgatgaccgcgatccaaactccatccca
gatgacgagcgcgattacttcctggagcgccgctacccggcgttcggcaacctcgttccc
cgtgacgttgcatcccgtgcgatttctcagcagatcaacgccggctacggcgttggccct
ctgaagaactctgtataccttgacttccgtgacgcaattcagcgtctaggcaaggacacc
atccgtgagcgttactccaacctcattgagatgtatgaagaagcaattggtgagtctgca
tacgaatccccaatgcgtattgcgcctacttgccacttcaccatgggcggtctgtggacc
gacttcaatgagatgacttccattgaaggtttgttcgccaccggtgaggcatcttggacc
taccacggtgctaaccgtctgggcgcaaactccctgttgtctgcttctgtcgatggctgg
ttcaccttgccattcaccgttcctcacttcttggctaagcacctcggtgaggagaagctg
gcggaggactccgctgaggcaaaggtagcggttgagcgtgcgcaggcacgtattgaccgc
ctgatgaacattcgtggtgaaaacccacacggtcctgcgtactaccaccgccagctcggt
gagattctgtactggggctgcggcgtttctcgaaacatcgaggatcttaagacctcgatt
gaaaagattcgcgaattgcgcaaggacttctgggcgaacgtacgtatcccaggctccgct
gatgacatgaaccaggtgctggagtacggtgcccgcgttgctgactacatcgacctcggt
gagctcatgtgtattgatgctctcgaccgcgatgagtcctgtggcgcgcactttcgtgat
gaccacctgtccgaagacggcgaagctgagcgcgatgatgagaactggtgcttcgtgtcc
gcttgggagccaggcgaaaccgaaggcgaattcatccgccacgctgaaccgctgtacttt
gattcgatcccgttgatgactaggaactacaagtaa

DBGET integrated database retrieval system