KEGG   Corynebacterium casei: CCASEI_02100Help
Entry
CCASEI_02100      CDS       T03041                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccg  Corynebacterium casei
Pathway
ccg00020  Citrate cycle (TCA cycle)
ccg00190  Oxidative phosphorylation
ccg00650  Butanoate metabolism
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01130  Biosynthesis of antibiotics
ccg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCASEI_02100
   00650 Butanoate metabolism
    CCASEI_02100
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCASEI_02100
Enzymes [BR:ccg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCASEI_02100
    1.3.5.4  fumarate reductase (quinol)
     CCASEI_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_18 Fer4_15 Fer4_16 Fer4_4 Fer4_2 Fer4_6 Fer4_3 Fer4_22 Fer2 Fer4_21 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AHI19005
UniProt: W5XQP8
LinkDB All DBs
Position
424531..425280
Genome map
AA seq 249 aa AA seqDB search
MKLTLKIWRQAGPTHDGNFETVQVDDAEEHMSILELLDHVNDQIIERGEEPFAFASDCRE
GICGTCGLTVNGRPHGPGQNTPACQQRLFQFTDGDTVTLEPFRSAAYPVIKDMVVDRRAL
DHVMEQGGYVSMDGGTAPDADTLHQNHETAEYALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLMPLGKDERGRRARNMVDDLETNFGHCSLYGECADVCPAGIPLTAVAAVTSERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgactttaaagatctggcgtcaggctggaccaacccacgacggtaactttgag
accgttcaggtcgacgatgccgaagaacatatgtcaatcctcgaacttcttgaccacgtc
aacgaccagattattgagcgtggcgaagagccgttcgcttttgcatctgactgccgtgaa
ggtatctgtggtacctgtggtttgaccgtaaatggccgcccgcacggccccggacaaaac
actcctgcttgtcagcagcgtttattccagttcactgatggcgacaccgtaaccttggag
cctttccgttccgctgcttacccagtaatcaaggacatggtcgttgaccgtcgcgccctt
gaccacgtcatggagcagggtggctacgtctccatggatggaggtactgcaccagatgca
gacaccttgcaccagaaccacgagaccgctgagtacgctctggaccacgcagcctgcatc
ggctgtggtgcttgtgttgcagcttgccctaacggcgctgctcacctgttcaccggtgca
aagctggttcacctctccctgatgcctttgggcaaggatgagcgtggccgtcgtgcacgc
aacatggttgatgacctggagaccaacttcggtcactgctccctctacggtgagtgcgcc
gatgtttgccctgcgggcatcccattgactgctgtggcagctgttaccagcgagcgtgct
cgcgcagctttccgcggcaaggatgactaa

DBGET integrated database retrieval system