KEGG   Corynebacterium casei: CCASEI_02720Help
Entry
CCASEI_02720      CDS       T03041                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ccg  Corynebacterium casei
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccg03012]
    CCASEI_02720
   03029 Mitochondrial biogenesis [BR:ccg03029]
    CCASEI_02720
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccg04147]
    CCASEI_02720
Translation factors [BR:ccg03012]
 Eukaryotic Type
  Elongation factors
   CCASEI_02720
 Prokaryotic Type
   CCASEI_02720
Mitochondrial biogenesis [BR:ccg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CCASEI_02720
Exosome [BR:ccg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CCASEI_02720
  Exosomal proteins of breast cancer cells
   CCASEI_02720
  Exosomal proteins of colorectal cancer cells
   CCASEI_02720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHI19127
UniProt: W5XQE7
LinkDB All DBs
Position
555570..556760
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTTTTAAITKVLADQYPDENEAFAFDMIDKAPEEKE
RGITINISHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQEFDEEAPIVHISALGAL
NGEEKWVNSVIELMQACDDAIPDPVRETEKPFLMPIEDIFTITGRGTVVTGRVERGQLKV
NEDIEIIGIQEKSISTTVTGIEMFRKMMDYTEAGDNCGLLLRGTKREEVERGQVAIKPGA
YTPHKKFEGSVYVLKKEEGGRHTPFMDNYRPQFYFRTTDVTGVVKLPEGVEMVMPGDNVD
MSVELIQPVAMDEGLRFAIREGSRTVGAGRVTKVVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagtttgagcgttcgaagccgcacgtaaacatcggcaccatcggacac
gtcgaccacggtaagaccaccaccaccgcagctatcaccaaggttctggctgaccagtac
cctgatgagaacgaagcgttcgctttcgacatgatcgataaggctcctgaggagaaggag
cgcggtattaccattaacatctcccacgttgagtactccacccctaagcgccactacgca
cacgtagacgctccaggccacgccgactacatcaagaacatgattaccggtgctgctcag
atggacggcgctatcctggttgttgctgcaaccgacggcccaatgccacagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgcactgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgttgagatggaagttcgtgaacttctg
gctgagcaggagttcgacgaggaagctccaatcgttcacatctccgctctgggcgccctg
aacggcgaagagaagtgggttaactccgttatcgagctcatgcaggcttgtgacgacgct
atcccagacccagttcgtgagactgagaagccattcttgatgccaatcgaggacatcttc
accattaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtcagctgaaggtc
aacgaggacatcgagatcatcggtatccaggagaagtccatctccaccaccgttaccggt
atcgagatgttccgcaagatgatggactacaccgaggctggcgacaactgtggtctgctt
ctgcgtggtaccaagcgtgaagaagttgagcgcggccaggttgctattaagccaggcgct
tacacccctcacaagaagttcgagggctccgtctacgtcctgaagaaggaagagggcggc
cgccacaccccattcatggacaactaccgtccacagttctacttccgcaccaccgacgtt
accggtgttgtgaagttgcctgagggtgttgagatggtcatgcctggcgacaacgtcgac
atgtccgttgagctcatccagccagttgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgtaccgttggtgctggtcgtgtgaccaaggttgttgagtaa

DBGET integrated database retrieval system