KEGG   Corynebacterium casei: CCASEI_02725Help
Entry
CCASEI_02725      CDS       T03041                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccg  Corynebacterium casei
Pathway
ccg00620  Pyruvate metabolism
ccg00680  Methane metabolism
ccg01100  Metabolic pathways
ccg01120  Microbial metabolism in diverse environments
ccg01200  Carbon metabolism
Module
ccg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCASEI_02725
  09102 Energy metabolism
   00680 Methane metabolism
    CCASEI_02725
Enzymes [BR:ccg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CCASEI_02725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AHI19128
UniProt: W5XY82
LinkDB All DBs
Position
complement(556873..559647)
Genome map
AA seq 924 aa AA seqDB search
MSEQVRDDIRLLGRILGRVIAEQEGEDVYELVESTRRLAFGVARGEEDAEALLSTFRDVD
ENKINLVARSFSHFALMANIAEDLDDESALAAREDSGEHAPDASLEGVLAKLKAADGVST
SEVTRVLDAALVSPVFTAHPTETRRRTVFDVQKRIIKLLRERHGILAQPQTPRRITRLAE
IEREAHLRMTILWQTALIRIARPQIEDEVNVGLRYFKRSLLEQVPAINRDTIAGLRDVFG
GAVPNRQVVRTGSWIGGDHDGNPYVTGETLTYATRTAADTVLEYHVDQLGLLEKELSISD
RYSESSAELQELAARGNNDVPSRVDEPYRRAIHGVLGRMTATRASIAGDSVKDAAQDEVN
EFAPYSSPAEFKAELDIIDRSLRQFNDAIIADDRLLRIRSALDSFGFHLNALDLRQNSES
FEAVLDELFAGAGVTASGAGYKGLNEQAKRELLAAELTSARPLTFPWSATYSEVTERELG
IFRAAADAVDTLGVDVVPHCIVSMTGTVSDILEPMVLLKEVGLLSFDPARGRLVGSVDIA
PLFETIDDLKAGAKILQELWDVPLYRDYLRGRGDTQEVVLGYSDSNKDGGYLSANWALYD
AQLEIVEACNTHGIGLRFSHGRGGAVGRGGGPTYDAILAQPEGAVRGSVRITEQGEVISA
RYGTATTARRHLEAFVAGTLEASLLNTEKLKEPERAYSIMREISGLAGEKYASLVRHDEG
FIDYFTQSTPLHEIGDLNMGSRPTARKQTESIADLRAIPWVLSWSQSRVNLPGWFGVGTG
ITRWAGDDDARWDDLRTLYHAWPFFRSVLDNMAQVMGKASMDLAKIYSTLVDDIETSQRV
YNTIAEEYALTREVFHRITDHDSLMAGNERLERSVQRRYPNLLPLNAIQIELLRRYRAGD
DSFLVSKTIQVTMNGLATGLRTSG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggttcgcgacgatatccgcttgcttggtcgaatcctcggccgggttatc
gctgagcaggaaggcgaggacgtatacgagctggtggagtccacccgccggctcgcgttt
ggtgtggcgcgcggtgaggaagacgccgaggctttgctatcgacgtttcgcgatgtggat
gagaacaaaatcaatttggttgcgcgttcctttagccactttgcgctgatggcgaatatc
gcagaggacttggatgatgaatcggcattggcagcgcgcgaagactcgggcgagcatgct
cccgatgcctcattggaaggcgtgctggccaagctgaaggctgccgatggcgtgagcacc
agcgaagtcacccgcgtgctggatgcagcactggtctcccctgtctttactgcgcacccg
acagagacgcgacgacgcacggtctttgatgtgcaaaagcgcattatcaaactgctgcgc
gagcgccacgggattctggcacagccgcagacaccgcggcggattacgcgcctagctgag
attgagcgtgaggcgcacttgcgtatgaccatcttgtggcaaacagcgctaattcgaatt
gcccggccgcagattgaggacgaggtcaatgtgggtctgcgctatttcaagcgcagcttg
ctggagcaggtacctgcgattaatcgcgacacgattgcgggcctgcgagacgtttttggc
ggcgcagtgcccaaccgtcaggtggtgcgtaccggttcctggatcggcggtgaccatgac
ggcaatccgtacgtcaccggtgagacgctgacttatgccacgcgtacggctgcggacacg
gtgctggagtatcacgtggaccagctcgggttgttggaaaaggagctgagcatctccgat
aggtattcagaaagctctgcggaattgcaggagttagccgcgcgcggcaataacgacgtt
ccaagccgcgtggatgagccttatcgtcgcgctatccacggcgtgctggggcgcatgact
gcgacgcgagcaagtatcgcaggagacagtgttaaagacgcagctcaagatgaggtcaac
gaatttgcgccctatagctctccggcagagtttaaggccgagctggacatcattgaccgc
tcgctgcgccaattcaatgacgccatcattgccgatgaccgcctcctgcgtatccgctcc
gcgctggactctttcggtttccacctcaacgccttggatttacgccagaactcagagtcc
ttcgaggcggtgctggatgagcttttcgcgggagcgggtgtcactgcttctggtgctggc
tataagggcctgaatgagcaagccaagcgcgaactgttagctgctgaactgacttctgca
cgtccgctgaccttcccgtggtctgcaacctatagcgaggtgactgagagggaactgggg
atatttcgggcagcagcagacgccgtggacacgctcggcgtcgatgtcgtcccgcactgc
attgtctctatgacaggcacagtaagtgacattctggagccgatggtgttgctcaaggag
gttggcctgctgagcttcgatcctgcgcgcgggcgactggtgggttccgtggatatcgca
ccgctgtttgaaaccatcgatgacttgaaggccggcgcgaagattctacaggagctatgg
gatgtaccgctctaccgtgactatttgcgtgggcgcggagacacccaagaagttgttttg
ggctattcggactctaataaggacggcgggtatctttccgccaactgggcgctctatgac
gcgcagctggagattgttgaggcctgcaatacccacggtatcggtttacgtttctcgcat
ggccgcggtggcgctgtgggccgcggtggtggaccgacctatgacgccatcttggcacag
ccagaaggcgcagtgcgcggctcagtacgcatcaccgaacaaggtgaggtcatctccgct
cgctatggcacagcaaccactgctcgccgtcacttggaagcatttgtcgcgggcacgcta
gaagcctcacttttgaatacggaaaagctgaaagaaccagagcgtgcttatagcatcatg
cgggaaatttccgggctcgccggcgagaaatacgccagcctggtgcgccatgatgaggga
ttcattgactacttcacccagtccacaccgctgcatgagattggtgatttgaacatgggc
tcacgcccgacggcccgcaagcaaaccgagtccattgcagacttgcgtgcaattccgtgg
gtgttgtcatggtcgcagtcgcgcgtgaatcttcccggctggttcggtgtcggcaccggc
atcacgcgttgggctggcgatgatgatgctcgttgggatgacctgcgtacgctataccac
gcatggccatttttccgctccgtgctggataacatggcgcaggtcatgggcaaggcttcc
atggatttagcgaagatttactccaccttggttgatgatattgagacgtcgcagcgcgtg
tacaacaccatcgcggaagaatacgctcttacccgcgaggtcttccatcgcattactgac
catgattccctgatggccggcaatgagcgtctggagcgctcagtacagcgccgctaccct
aatctgctgccgcttaacgcgattcagattgagctgctgcgccgctaccgtgccggcgac
gactcattcctagtgtcgaagaccatccaagtcaccatgaacgggcttgccacgggattg
cgtacttcaggttaa

DBGET integrated database retrieval system