KEGG   Corynebacterium casei: CCASEI_04040Help
Entry
CCASEI_04040      CDS       T03041                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ccg  Corynebacterium casei
Pathway
ccg00250  Alanine, aspartate and glutamate metabolism
ccg00280  Valine, leucine and isoleucine degradation
ccg00410  beta-Alanine metabolism
ccg00640  Propanoate metabolism
ccg00650  Butanoate metabolism
ccg01100  Metabolic pathways
ccg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCASEI_04040
   00650 Butanoate metabolism
    CCASEI_04040
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCASEI_04040
   00280 Valine, leucine and isoleucine degradation
    CCASEI_04040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCASEI_04040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccg01007]
    CCASEI_04040
Enzymes [BR:ccg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CCASEI_04040
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CCASEI_04040
Amino acid related enzymes [BR:ccg01007]
 Aminotransferase (transaminase)
  Class III
   CCASEI_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHI19386
UniProt: W5XR48
LinkDB All DBs
Position
830907..832220
Genome map
AA seq 437 aa AA seqDB search
MKDFDYHLPQERRVVTDGMGEKSAEINARREAAIARALTPGLPGYVVTADGGVLVDADDN
SYIDFASGIAVTSVGASNKRVADAVSKAAAQFTHTCFMVSPYESYVAVCEKLNQLTPGDH
EKKSVLLNSGAEAVENAVKIARKYTGKNAVAVFDYGYHGRTNLTMSMTAKNKPYKTGFGS
LASDVHRVPMSYPARDGLKGDQAAARAIKVLDQQVGPENLACVVIEPVQGEGGFIVPAEG
FLPAIAQWCRDNDVVFIADEIQSGFGRTGQWFASENEQVIPDLVTTAKGIAAGMPLSGVT
GRAEIMDSPIPGSLGGTYGGNPVACAAALAAIEEFEAHDLPGRAREIEAIVREYFEPLLE
LESVLDVRGRGAMMAIELINAEVTNEIAAACKKQGILILTCGLDGNVIRLLPALTIPEHL
LREGLEILTTEIREALA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgattaccacctgccgcaggagcgtcgagtagtcactgatggaatggga
gaaaagagcgcggagattaatgcgcgccgtgaggcagccattgcccgtgccctgacccca
ggtctgcctggatatgtcgttactgcagatggtggtgtcctggttgatgccgatgacaac
tcatacatcgatttcgcatccggcattgctgtgacgtccgttggtgcttccaataagcga
gttgcagatgctgtgtctaaggctgccgcacaatttacccacacctgtttcatggtctcc
ccatatgagtcctacgtagcggtgtgtgaaaagctaaaccagctcaccccaggtgaccat
gagaagaagtccgttcttctaaactctggtgctgaggcagtagaaaacgcagtcaagatt
gcgcgtaagtacaccggcaagaatgccgtggcagtttttgactacggttaccacggccgt
accaacctgaccatgtccatgacggcgaagaacaagccttacaagacaggtttcggcagc
ttggcttccgatgtccaccgggtgccaatgtcctacccagcacgtgatggtctcaagggt
gatcaggcagcagcacgcgcaatcaaggtgctcgaccagcaggtcggacctgaaaacctg
gcgtgtgttgtcatcgagccagtccagggtgagggcggtttcatcgtcccagctgaaggc
ttcttgccagccattgcgcagtggtgccgcgataatgatgtcgtcttcatcgctgatgaa
atccagtccggcttcggccgaaccggccagtggttcgcgtctgagaacgagcaggtcatc
ccagacctggtgaccactgcgaagggtatcgctgctggtatgccactatctggtgtgact
ggccgtgcggaaatcatggacagcccaatcccaggctctttgggcggtacctacggcggc
aacccagttgcttgtgccgcagcgctcgcagcaatcgaagagtttgaggcccatgacctg
cctggtcgtgcacgtgaaatcgaagcaatcgttcgcgagtacttcgagccactgctcgaa
ttggaatccgtcctagatgttcgcggtcgcggcgccatgatggccattgagctcatcaac
gccgaggtcaccaatgagattgctgctgcatgtaagaagcagggcatcctcatcttgacc
tgtggtctggacggcaacgtcattcgtttgctgcctgcgttgaccatcccggagcacctg
ctgcgtgaaggtctggaaatccttaccacggaaatccgcgaggctctcgcctaa

DBGET integrated database retrieval system