KEGG   Corynebacterium casei: CCASEI_04050Help
Entry
CCASEI_04050      CDS       T03041                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ccg  Corynebacterium casei
Pathway
ccg00290  Valine, leucine and isoleucine biosynthesis
ccg00650  Butanoate metabolism
ccg00660  C5-Branched dibasic acid metabolism
ccg00770  Pantothenate and CoA biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
ccg01210  2-Oxocarboxylic acid metabolism
ccg01230  Biosynthesis of amino acids
Module
ccg_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ccg_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCASEI_04050
   00660 C5-Branched dibasic acid metabolism
    CCASEI_04050
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CCASEI_04050
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CCASEI_04050
Enzymes [BR:ccg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CCASEI_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AHI19388
UniProt: W5XYZ0
LinkDB All DBs
Position
complement(833545..835161)
Genome map
AA seq 538 aa AA seqDB search
MTTRNGGDLVVETLQALGIKDVFGIPGQHALGLFDALSRSSLNFYSSRVENNAAFAADGY
ARATGNPAALFLSTGPGALTSLAGLQEAYATGVPMIVVSSQIPAAGLGARRKGMLHQLDE
QTESVRNVTKYQATVQQAAAIPSVLEDACREAMTAPQGPVWVEVPQDILLESQDTAHGLP
AITAATTAAEINQPEAHHALVSRAAELINANSTVIVAGGGVRRSGAGELLVQLAEKIDAP
VVCTVGGNTALPLDHPLAVHFIEDRHVTDLMDSAETLLVLGSSLGEVTSNYFTMKPTGTI
IQVDAESKVLSSNHPSLGIRADISTFLAQLLPAVDTATHAGADKAAEVNTKVAERMSELG
LEHEQQVMDAIREAVPDDMQAYWDMTIAAYWAWNVWDAKDGEFHSAQGAGGLGYGFPAAL
GGALGLGKRTFALAGDGSSLYSTSELAAAVQHDIPVTWLIVDDGGYGILREYMNEAFGKA
TATELARPDFVKLAESFGVPAFRAEKETLQEVLSQALDAESGPNVVVLETHLKMWELT
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcaatggcggcgacctggttgttgaaaccctgcaagcgctgggcatcaag
gatgtctttggtatccctggccagcacgcattggggctttttgatgccctgtcgcgcagt
tctttgaacttttactccagccgcgtggagaacaatgcagcctttgcggctgatggttat
gcacgtgcgaccggcaacccggcggcactgtttttgtccactggccccggcgcgctgacc
tcgcttgctgggctccaggaggcttatgccactggtgtgccaatgattgtggtgtcttcg
cagattccggccgcgggcctgggcgcgcgccgcaagggcatgctgcaccagctggatgaa
cagactgaatccgtgcgcaacgtaaccaaatatcaggcgacggtgcagcaggctgctgcc
attccaagcgttctggaagatgcttgccgtgaggcaatgactgcgccgcaggggccagtg
tgggtggaggttccgcaggacatcttgttggaatctcaggacaccgcgcatgggctaccg
gcgattaccgccgcgaccaccgcggcggagatcaaccagccggaagcacaccacgcactg
gtgagccgcgcggcggaactgattaacgcgaactccaccgtcattgttgccggcggcggc
gtgcgtcgctccggcgcgggtgaactgctagtgcagttggcggaaaagattgatgcgccg
gtggtgtgcactgtcggtggtaacactgccctgccgttggatcatccactggccgtgcat
tttatcgaagaccgccatgtcacagacctgatggatagtgctgaaaccctgctagtgttg
ggcagctccctgggtgaggtgacgtccaattacttcactatgaagccaactggcaccatc
atccaggtggatgctgagtccaaggtcttgtcttcaaatcatccttcactgggtattcgc
gcggatatctccactttcttggcgcagctgcttccagcggtagatactgcaacgcatgct
ggcgcggacaaggcagctgaagtaaacaccaaggtggcggagcgcatgagcgagcttggc
ctggagcatgagcagcaggtcatggatgcaattcgggaggctgtgccggatgacatgcag
gcctattgggatatgaccatcgctgcttattgggcgtggaatgtgtgggatgccaaggac
ggcgaattccactcggcacaaggcgccggtggcctaggctatggcttccccgccgccttg
ggcggcgcactaggactgggcaagcgcacctttgcgctggccggtgacggctcttccctt
tactccacttcagaactagcagccgcagtccagcatgatattccggtgacttggctgatt
gtggatgatggcggctacggcatcttgcgcgagtacatgaatgaagctttcggcaaagcc
accgctacggagctcgcgcgtcctgactttgtgaaactcgcagagtccttcggagttcca
gcgttcagggcagaaaaagagaccctgcaagaagtactgtcacaagcacttgatgcagag
tctggccccaacgttgtggtgttggaaacccacttgaagatgtgggagctaacctag

KEGG   Corynebacterium casei: CCASEI_08355Help
Entry
CCASEI_08355      CDS       T03041                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase 3 regulatory subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ccg  Corynebacterium casei
Pathway
ccg00290  Valine, leucine and isoleucine biosynthesis
ccg00650  Butanoate metabolism
ccg00660  C5-Branched dibasic acid metabolism
ccg00770  Pantothenate and CoA biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
ccg01210  2-Oxocarboxylic acid metabolism
ccg01230  Biosynthesis of amino acids
Module
ccg_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ccg_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCASEI_08355 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    CCASEI_08355 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CCASEI_08355 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CCASEI_08355 (ilvH)
Enzymes [BR:ccg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CCASEI_08355 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT DUF2187
Motif
Other DBs
NCBI-ProteinID: AHI20236
UniProt: W5XTD4
LinkDB All DBs
Position
complement(1817056..1817577)
Genome map
AA seq 173 aa AA seqDB search
MPAPHEVTRHTLSVLVEDVEGITSRVAGMFTRRGYNLVGIVSAKTETPGISRFTIVVDAN
EVVTEQVTKQLNKLIPVIKVVELDDETSVARGIMLVKVAADNTNRPQVVDAVNIFRARVV
DVAQESVIVEATGSPGKLRALLDVLEPFGIRELIQSGHVALSRGPKAMAPTKL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccacacgaagtcacccgccatactttgtctgtcctggttgaggacgtggaa
ggtatcacctctcgcgtcgccggtatgttcacccgccgtggttacaacctagtgggcatt
gtctcagctaagactgagacccctggcatcagccgcttcacaatagttgttgatgccaat
gaagtagtgaccgaacaggttacgaagcaactcaacaagctcatcccagtcatcaaggtg
gttgagcttgatgatgaaacctcagtggcccgcggcatcatgctggtcaaggttgcagcg
gacaacaccaaccgtccgcaggttgtggacgccgtcaacatcttccgtgcacgcgttgtg
gacgtggctcaggaatccgtcatcgtggaagctacgggttccccaggaaagctgcgcgca
ctacttgatgttctggaaccattcggcatccgcgaactcatccagtccggccacgtggcg
cttagccgcggccccaaggccatggcccccaccaaattgtaa

KEGG   Corynebacterium casei: CCASEI_08360Help
Entry
CCASEI_08360      CDS       T03041                                 

Definition
(GenBank) acetolactate synthase 1 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ccg  Corynebacterium casei
Pathway
ccg00290  Valine, leucine and isoleucine biosynthesis
ccg00650  Butanoate metabolism
ccg00660  C5-Branched dibasic acid metabolism
ccg00770  Pantothenate and CoA biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
ccg01210  2-Oxocarboxylic acid metabolism
ccg01230  Biosynthesis of amino acids
Module
ccg_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ccg_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CCASEI_08360
   00660 C5-Branched dibasic acid metabolism
    CCASEI_08360
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CCASEI_08360
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CCASEI_08360
Enzymes [BR:ccg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CCASEI_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AHI20237
UniProt: W5XTI5
LinkDB All DBs
Position
complement(1817577..1819445)
Genome map
AA seq 622 aa AA seqDB search
MAASTTPTPASVASSTGAKPGPKGPERMTGAQAIVRTLEDLGTDLVFGIPGGAVLPLYDA
INRSETLRHVLTRHEQGAGHAAEGYALACGKVGVCIATSGPGATNLVTPIADANLDSVPL
VAITGQVGSNLLGTDAFQEADIRGVTMPITKHNFIVTDPNKIPEAIAAAFHLASTGRPGP
VLVDIPKDIQNATVEYSFPTKFYMPGYKPTTNPHNRQISAAVKLISEASRPVLYIGGGVV
KADAHRELLEFAEFTGIPVVTTLMALGAFPDSHPQHMGMPGMHGTVPAVAAMQRSDLLIA
IGARFDDRVTGDVDTFAPHAKAIHADVDPAEIGKIREVSVPIVGDAREVLLALTKTYQNS
TKYPKPEIEEWTGYLSDLQDRFPRGWEPTEDGKLNPQQILEHLSAEIGPEAIYVAGVGQH
QMWAAQFIDFENPRTWLNSGGAGTMGYAVPAALGAKAAMPDKEVWAIDGDGCFQMTNQEL
TTAALEGFPIKVAVINNGNLGMVRQWQTLFYERNYSNTKLREEASYVPDFVKLSEAMGCE
SIRVTTEEEILPAIQRAREINDRPVVIDFIVGEDAQVWPMISGGASNEEIQYALGLRPLF
DENESAAEEPATIHETVEETED
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcttccacaacgcccactccggcttcggtggcctcttctactggcgctaagcca
ggaccaaaaggcccggagcgaatgactggcgctcaagctattgtccgcacactagaagac
cttggtacggacctcgtatttggtatccctggcggcgccgtgctgcctttgtacgatgcc
atcaaccggtctgaaaccctgcgccacgtgctcacccgccatgagcagggtgctggccac
gccgctgaaggctatgcattggcatgtggcaaggtcggcgtttgtatcgcgacctctggt
cctggtgccaccaacttggtcaccccgattgctgatgccaacttggactccgtgcccctg
gtggcaattactggccaggtgggttccaacctgttgggcactgatgccttccaggaggcg
gacatccgcggtgtgaccatgcctattaccaagcacaacttcattgttactgacccgaac
aagattccagaggcaatcgctgcggcattccacctggcgtccacgggccgcccaggtcca
gttctggtggatatcccgaaggatattcagaacgcgacggtggagtactctttcccgacg
aagttctacatgccgggttacaagccaaccaccaatcctcataaccgtcagatctcggcg
gcagtgaagctgatttctgaggcttcccgcccagttctctacatcggtggcggcgttgtg
aaggccgatgcgcaccgtgagctgctggagttcgccgaattcaccggcatcccagtggtt
accactttgatggctttgggtgctttcccagattctcacccgcagcacatgggtatgccg
ggcatgcacggtacggttccggccgtggccgcgatgcagcgctcagacttgctcattgct
atcggcgcgcgttttgatgaccgcgtgaccggcgatgttgataccttcgcaccgcacgcg
aaggcaattcacgctgatgttgacccagcagagattggcaagattcgggaagtttccgtt
ccaatcgttggcgatgcgcgtgaggtgctcttggctttgaccaagacctaccaaaacagc
accaagtacccgaagccagaaattgaagagtggaccggctacttgagcgatctgcaggac
cgtttcccacgcggttgggagccaactgaagatggcaagctcaacccacagcagattctg
gagcacctctccgcagagatcggcccggaggccatctacgtggcaggcgttggccagcac
cagatgtgggctgcacagtttattgactttgaaaacccacgtacctggctcaactccggc
ggcgccggcaccatgggctacgccgttcccgccgctttgggcgcaaaggcagcgatgccg
gacaaggaagtctgggcgattgacggtgatggttgtttccagatgaccaaccaggagctg
accaccgcagcgttggaaggattccccatcaaggtcgctgttatcaacaacggcaaccta
ggcatggtgcgccagtggcagactctgttctatgagcgcaactactccaacaccaagctg
cgcgaggaagcatcgtacgttcctgactttgtaaagctttcggaggcaatgggctgtgaa
tccatccgcgtgaccacggaggaagagatccttccagcaattcagcgggcacgcgaaatc
aatgaccgccccgtggttattgacttcattgtgggtgaagacgcccaggtctggccaatg
atttccggtggtgcatcaaatgaagaaatccagtacgcactgggtcttcgcccactcttt
gacgaaaacgaatcggcggctgaagaaccggcgacaattcatgaaacagtagaggagacc
gaagactaa

DBGET integrated database retrieval system