KEGG   Corynebacterium casei: CCASEI_06605Help
Entry
CCASEI_06605      CDS       T03041                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ccg  Corynebacterium casei
Pathway
ccg00010  Glycolysis / Gluconeogenesis
ccg00520  Amino sugar and nucleotide sugar metabolism
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01130  Biosynthesis of antibiotics
ccg01200  Carbon metabolism
Module
ccg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCASEI_06605
   00520 Amino sugar and nucleotide sugar metabolism
    CCASEI_06605
Enzymes [BR:ccg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CCASEI_06605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AHI19893
UniProt: W5Y0B2
LinkDB All DBs
Position
complement(1422909..1423661)
Genome map
AA seq 250 aa AA seqDB search
MKTSFGIDVGGSGIKGAVVNLDTGEFVGDRIKISTPKPATPEAVASTVAEIVEQAGWEGP
VGITLPSIVKGQMVLSAANVDKSWIGVDAYELFHRHLGSDRHISVLNDADAAGLAEVAFG
DTKAKEGPVIFLTIGTGIGSALLLDGKLWPNAELGHLIVGDDEAEHQASSAVKEDKDLSF
KKWAKHVNRVLHEYEALFNPNLFIIGGGISRRFEKWGPHLTIKTEVVPAHLRNKAGIIGA
AMAVTRDIAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttcttttggcattgatgtgggcggctctggcatcaaaggcgccgtagtcaat
ttagacaccggcgagtttgttggagaccgcatcaagatttcaaccccgaaaccggcaact
cccgaggcagtcgcatccacggtggcagaaatcgtggagcaggcaggttgggagggcccg
gttggcatcaccttgccttccatcgtgaaaggtcagatggtcctctcagcggccaatgtt
gataagtcatggattggggtggatgcctacgagctcttccaccgccacctaggttccgat
aggcacatttcagtgcttaacgatgccgacgcggccggcctggcagaggttgctttcggc
gataccaaggcaaaagaagggccagtcatcttcctcaccattggcaccggtattggttca
gccttattgctggacggaaagttgtggccgaacgcggaacttggacatctcatcgtcggc
gatgatgaggcagaacaccaagcatcatcggcggtcaaagaagacaaggatctatcgttc
aagaagtgggcgaagcacgttaatcgcgtgctgcacgagtatgaggcgctgtttaatccg
aacctgttcattatcggcggaggaatctcgcggcgctttgaaaaatggggaccgcatttg
accatcaagactgaggttgttcctgctcatctacgcaataaggcaggaatcatcggcgcg
gcgatggccgttactcgtgacatcgcgccataa

DBGET integrated database retrieval system