KEGG   Corynebacterium casei: CCASEI_07795Help
Entry
CCASEI_07795      CDS       T03041                                 

Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
ccg  Corynebacterium casei
Pathway
ccg00220  Arginine biosynthesis
ccg00250  Alanine, aspartate and glutamate metabolism
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
ccg01230  Biosynthesis of amino acids
Module
ccg_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCASEI_07795
   00220 Arginine biosynthesis
    CCASEI_07795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccg04147]
    CCASEI_07795
Enzymes [BR:ccg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     CCASEI_07795
Exosome [BR:ccg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCASEI_07795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-ProteinID: AHI20128
UniProt: W5Y0W3
LinkDB All DBs
Position
complement(1692795..1694015)
Genome map
AA seq 406 aa AA seqDB search
MNARVVLAYSGGLDTSVAIPYLSKMTGGDVVAVSLDLGQGGEDMESVRQRALDCGAVESI
VIDAKDEFAEEYCLPTIQANGMYMKQYPLVSAISRPLITKHLVKAAQEFGGTHVSHGCTG
KGNDQVRFEVSFRALDPSLDIIAPARDYAWTRDKAIAFAEEIDLPIEQSASSPFSIDQNV
WGRAVETGFLEDLWNPPTKDVYAYTEDPALGNAPDEVVISFEKGKPVAIDGKQVTVLQAI
EELNRRAGAQGIGRLDMVEDRLVGIKSREVYEAPGAITLIRAHEALEDVTMERELARYKR
LTDARWSEEVYDGLWYSPLKRSLDAFIAESQEHVTGDIRLVLHAGQIVVNGRRSPQSLYD
FSLATYDTGDAFDQTAAKGFVQLHGLSTQISNKRDRDGGFPTSASE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgtgtcgtgcttgcttactccggcggcctggatacctcggttgccatccct
tacctgtctaagatgaccggtggcgacgttgtcgcagtatcgctggatctgggccagggc
ggcgaggacatggaatctgtccgtcagcgcgcactggattgcggcgcggtggagtccatt
gtcattgacgccaaggatgagttcgcggaagagtactgcctgccaaccattcaggccaac
ggcatgtacatgaagcagtacccactggtttctgctatctctcgtccgctgattactaag
cacctggtgaaggctgctcaggaattcggtggcacccacgtctcccacggttgcaccggc
aagggaaatgaccaggtccgcttcgaggtttctttccgcgcgctggatccatccctggac
atcattgcgccggcacgtgactacgcatggacccgtgacaaggctattgcttttgctgaa
gagattgacctgccaattgaacagtcagcttcctcaccattctccattgaccagaacgtc
tggggccgcgcggttgaaactggcttcctggaggatctgtggaacccaccaacaaaggat
gtctacgcctacaccgaggatccagcactgggcaacgcaccggatgaggttgtcatctcc
tttgagaagggcaagccagtagctatcgatggcaagcaggtcaccgtcctgcaggccatt
gaagagcttaaccgtcgtgcaggcgcacagggcattggccgtctggacatggtcgaagac
cgcctggtgggcatcaagtcccgcgaggtctacgaagcaccgggtgcaattaccttgatt
cgtgcacacgaagctttggaagatgtcaccatggagcgcgagctggcacgctacaagcgc
ctgactgatgctcgttggtccgaggaggtctacgacggtctgtggtactccccgctgaag
cgttctttggatgcgttcattgctgagtcccaagagcacgtcaccggcgatatccgtctg
gtgctgcacgctggtcagatcgttgtcaacggtcgtcgttccccacagtctctctatgac
ttctccttggctacctacgacaccggtgatgccttcgatcagaccgcagcgaagggcttt
gttcagctgcacggtctgtccactcagatttctaacaagcgtgaccgcgatggcggtttc
ccaaccagcgcatctgagtaa

DBGET integrated database retrieval system