KEGG   Corynebacterium casei: CCASEI_09520Help
Entry
CCASEI_09520      CDS       T03041                                 

Gene name
ispH
Definition
(GenBank) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
ccg  Corynebacterium casei
Pathway
ccg00900  Terpenoid backbone biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
Module
ccg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCASEI_09520 (ispH)
Enzymes [BR:ccg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     CCASEI_09520 (ispH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LYTB Ferrochelatase DUF1363
Motif
Other DBs
NCBI-ProteinID: AHI20461
UniProt: W5XU22
LinkDB All DBs
Position
complement(2072772..2073725)
Genome map
AA seq 317 aa AA seqDB search
MTEAGKNVLLAAPRGYCAGVDRAVETVEKALNKYGAPIYVRKQIVHNKYVVESLAKRGVI
FVEEASEAPEGAHLVFSAHGISPAVRKEAEGRKQLTLDATCPLVTKVHREANRFDRDGYH
ILLVGHEGHEEVEGTAGQAPEVTHLVDGVEGVDKLPQWLENEKLVWLSQTTLSVDETIEI
VNHLRKRFPHLENPPSDDICYATQNRQESVKAIAPKCDLMIVVGSTNSSNSVRLVEVALD
AGSKTSYLVDYASEIQEEWLDGVETVGVTCGASVPELLVREVLEFLDDRGFNSVEQVTTT
TETIQFSLPRELRPART
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggcaggaaagaatgttctcctggcggcaccccgcggctattgcgccggtgtg
gatcgtgcagttgagacagttgaaaaggcacttaataagtacggcgcaccaatttatgtg
cgtaagcaaattgttcacaacaaatacgtcgttgaatcgttggcgaagcgcggcgtcatt
tttgtggaagaggcatccgaagctccagagggcgcacacctagtattctccgcccacggc
atttctccagccgtgcgcaaggaagctgaaggacgcaaacagctgactttggacgcgacc
tgcccactggtgaccaaggtgcaccgtgaggctaaccgcttcgaccgcgacggctaccac
atccttcttgttggccacgaaggccacgaagaggttgaaggcaccgccggccaggctcca
gaggtcacccacctggtggatggcgtagaaggcgtggacaagcttccacagtggcttgaa
aatgagaagctggtttggctgtcccagaccacgttgtcggtggatgaaaccatcgagatt
gttaaccatctgcgcaagcgtttcccacatttggaaaacccaccttcagatgacatctgc
tacgcaacgcagaaccgtcaggaatctgtgaaggctattgctccaaagtgtgacctgatg
attgttgttggttccacgaactcatcgaactccgtgcgtctggttgaggttgccctggat
gcaggttctaagacttcttacttggtggactacgcatcggagattcaggaagaatggctc
gacggcgtggaaaccgttggcgtcacctgtggtgcttccgttcctgagctacttgttcgc
gaggttctcgaattcctcgacgaccgtggcttcaacagtgttgagcaggtaaccaccacg
accgagaccattcagttctcgcttccacgcgaactgcgtccggcacgcacctaa

DBGET integrated database retrieval system