KEGG   Corynebacterium casei: CCASEI_09610Help
Entry
CCASEI_09610      CDS       T03041                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ccg  Corynebacterium casei
Pathway
ccg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01130  Biosynthesis of antibiotics
ccg01230  Biosynthesis of amino acids
ccg02024  Quorum sensing
Module
ccg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCASEI_09610
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CCASEI_09610
Enzymes [BR:ccg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CCASEI_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AHI20479
UniProt: W5XV13
LinkDB All DBs
Position
complement(2090269..2091351)
Genome map
AA seq 360 aa AA seqDB search
MSRPVSLTAPASTSNRRVKAFHQLPSPAELQAESPLSEKQAAKVEQDRQEIADIFAGEDD
RLVVVVGPCSIHDPVAALDYANRLSPLARALEEDLKVVMRVYFEKPRTTVGWKGLINDPH
LDQSFDIPSGLRTARKVLTDIVNLDLPAACEFLEPNSPQYYADAVAWGAIGARTTESQVH
RQLASGMSMPIGFKNGTDGNVDVAIHAASSAASPHFFFGTSDDGQPSVVETAGNQHCHII
LRGGSQGPNWDAESVAQVTAKLGDNARLMIDASHANSGKDHLRQVEVTRGIVKQIANGNE
HIAGIMMESFLEGGAQSLDAKGKDGLTYGQSITDACMDIDDTVDLLAELASAVRARRQAR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcccgtatcgctcaccgcgccagcatcgacctccaaccgccgcgttaaggca
ttccaccaactgccgagcccagcggagttgcaagcggagtcgccgctgagtgagaaacaa
gcagcgaaggtggaacaggaccgccaggaaatcgcggatatcttcgccggtgaagatgat
cgactcgtcgtagttgtcggaccgtgctccatccacgatccagtcgctgcccttgattac
gccaaccgtttgtccccactggcacgcgcactcgaggaagacctgaaggttgttatgcgc
gtgtactttgaaaagccacgcaccaccgtgggctggaagggacttatcaatgacccgcac
ttggatcagtccttcgacattccctccggtctgcgcaccgcacgcaaggtgctcactgac
attgtgaacttagacctgccagctgcgtgcgagttcctcgagccaaacagcccgcagtac
tacgctgatgccgtggcatggggcgcgattggtgctcgcaccaccgaatcccaggtgcat
cgacagcttgcttctggcatgtccatgccgattggtttcaaaaacggcaccgacggcaac
gttgacgttgcgatccacgcggcatcctccgctgcctccccgcacttcttcttcggtact
tctgatgacggccagccatcggttgtagaaaccgctggaaaccagcactgccacatcatc
ctgcgcggtggctcccaaggcccgaactgggacgcagaatccgtagcccaagtcaccgcc
aagctcggcgacaatgcgcggctgatgattgatgcttcccatgccaactccggcaaagat
catttgcgccaagtcgaggttacccggggcatcgtcaagcaaattgcgaacggcaatgag
cacattgccggcatcatgatggaatccttccttgagggcggcgcgcaatccctggatgcg
aaaggcaaagatggcttgacctacggccagtccatcaccgatgcctgcatggatattgat
gacaccgtggatttgttggctgagttggcctctgccgttcgcgcccgccgtcaggcacgc
tag

DBGET integrated database retrieval system