KEGG   Corynebacterium casei: CCASEI_12055Help
Entry
CCASEI_12055      CDS       T03041                                 

Definition
(GenBank) Serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
ccg  Corynebacterium casei
Pathway
ccg00270  Cysteine and methionine metabolism
ccg00920  Sulfur metabolism
ccg01100  Metabolic pathways
ccg01110  Biosynthesis of secondary metabolites
ccg01120  Microbial metabolism in diverse environments
ccg01200  Carbon metabolism
ccg01230  Biosynthesis of amino acids
Module
ccg_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CCASEI_12055
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CCASEI_12055
Enzymes [BR:ccg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     CCASEI_12055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 SATase_N
Motif
Other DBs
NCBI-ProteinID: AHI20961
UniProt: W5XVD6
LinkDB All DBs
Position
2641120..2641692
Genome map
AA seq 190 aa AA seqDB search
MNPLTISSRIREDLKNAREHDPAARSDVENAVVYSGLHAIWLHRICHWMWKRNIKGPARI
LAQFNRFLTGIEIHPGATIGRRFFIDHGMGIVIGETAEIGDGVMLYHGVTLGGQVLTQTK
RHPTLKDNVVVGAGAKVLGPITIGEGSAVGANAVVTKDVPDNHTATGIPAKNRPRKKEEQ
IKLVDPDYFI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctttgactatcagttctcggattcgggaagaccttaaaaatgcccgcgagcat
gaccctgctgctcgcagcgacgttgaaaacgctgtcgtttattccggtcttcacgccatc
tggcttcaccgcatttgccactggatgtggaagcgcaacatcaagggaccggcacgcatt
ttagcccagttcaaccgcttcctcacgggcattgaaatccaccctggtgcgactattggc
cgccgcttctttattgaccacggcatgggcatcgttattggtgaaaccgccgaaattggt
gacggtgtcatgctgtaccacggcgtcacgctgggtggccaggtgcttacgcaaactaag
cgccacccaactttgaaggacaacgttgttgtcggcgccggcgcaaaggtcttgggcccc
atcactatcggtgaaggctccgctgttggcgccaacgcggtagtgacgaaggatgtgcca
gataaccacaccgctaccggtattccagcgaagaaccgacctcgcaagaaagaagagcag
atcaagctggttgacccggattacttcatctag

DBGET integrated database retrieval system