KEGG   Corynebacterium casei: CCASEI_12770Help
Entry
CCASEI_12770      CDS       T03041                                 

Definition
(GenBank) serine/threonine protein kinase PknG
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
ccg  Corynebacterium casei
Brite
KEGG Orthology (KO) [BR:ccg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccg01001]
    CCASEI_12770
Enzymes [BR:ccg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CCASEI_12770
Protein kinases [BR:ccg01001]
 Serine/threonine kinases: Other
  Bacterial family
   CCASEI_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase Pkinase_Tyr TPR_19 APH PknG_rubred RIO1
Motif
Other DBs
NCBI-ProteinID: AHI21104
UniProt: W5XWP6
LinkDB All DBs
Position
2795807..2798422
Genome map
AA seq 871 aa AA seqDB search
MTHNFSDDELNYLDPAKGKEQPGTEAVAFDPFADDDEEEVNTTAAAEAAAADAEEERDDV
EIEALLKQVGASEGAAATEAVAYDPFADDELEDEDEGTSAVAFDPFADDDDDTDGHSEES
FTDSDNIAALIKDLGVLRDKREKRRGNASALIDTSQRSRQQALDTFRELRLAARTNREVA
DGMVSLPYVVPTDPEYALMDPTEATKEKKLAPPQLKPGDIVASQYEILGVIAHGGMGWIY
LANDHFVSGRVVVLKGMQAHKSADETAAAEAEREFLADITHPGIVKIFNFIDDARVPGGF
IVMEYVGGPSLRKRRNALPERRLPFTIAIAYILELLPALDYLHSRGVVYNDLKPDNIIVT
EDQVKLIDLGAVSGIGAFGYIYGTKGFQAPEVPTEGPSVSSDIYTIGRTLAALTLKLPHE
DGVFLPGIPNPTQEPRLRRHVSFYRLLQRATNPDPKKRFKDISEMRTQLYGVLREIIAIR
DGIQHPAQHSLFSPARSTFGTKHLVFRTDQLIDGIERTVRITAPEVVSALPTPLLDRDDV
GAALLQGYSYTEPQEALETLRQAMQTVEYEESAEIPFGVVRSMLDLGYTGQAKQWLEKLE
SRLGEDWRFQWYSGVTQLLLEDFTASQLHFSNMLEILPGEAAPKLALAAVNELLLQSMGY
SEQQLLEPAVARACANITSNLYELDDEYFVDQTIWEHISSDPKRIRFNSLRLYGTVWATN
PTTVSSAFGLARLLRAENQVEMAVATLDRVPNASRHQRMARLTTIVQLISQDVNESRVRR
AARRLEEIPTNEPRFLQIKIAVITAGLSFLRDSKLQAAASPNDLFEYAFTERGLRYGLAD
TLRALARQAPFSRHRYALVDLANQVRPVTTF
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgactcataacttctctgatgatgaactcaactacctcgaccccgcaaaaggcaaggaa
cagccgggcaccgaggcagtcgccttcgaccccttcgccgatgatgacgaagaggaagtc
aacaccacggccgcggcagaagcagctgctgccgatgccgaagaagagcgcgacgatgta
gagattgaggcgctgttgaagcaggtgggggcatcggaaggcgctgctgcgaccgaagcc
gtagcttatgacccgtttgctgatgatgagctcgaggacgaagacgaaggcacctccgcc
gttgcctttgaccctttcgccgatgacgatgatgatacggatgggcactccgaagaatct
ttcaccgactccgacaacattgcagcacttattaaagacctcggcgtgctgcgcgataag
cgcgaaaagcgacgtgggaatgcctcggcgttgattgacacctcgcagcgctcccgccag
caggcgctggatactttccgtgagctgcgcctggccgcgcgcaccaaccgcgaagtcgcc
gacggtatggtgtctttgccttatgtggtccccaccgaccccgaatacgccctgatggac
ccgacggaggccactaaagaaaagaagctcgcaccgccgcagcttaaacccggcgacatt
gtggccagccagtatgagattttgggcgttattgcccacggcggcatgggctggatttac
ttggccaatgaccacttcgtgtccggacgcgtggtggtgctcaaaggcatgcaggcgcac
aagtctgccgatgaaaccgcagccgccgaagccgaacgcgaattcctggcggatattaca
cacccgggcatcgtgaaaatttttaacttcatcgacgacgcccgcgtgcccggcgggttc
attgtcatggagtatgtcggcgggccttcgctgcgcaagcgccgcaatgcgctgccagag
cgccgacttccgtttaccatcgcgattgcctacatcctggaactgttgcccgcgctggat
tacctgcactcgcgcggcgtggtctataacgacctcaagccggacaacatcattgtcacc
gaggaccaggtcaagctcatcgacctaggcgcggtgtctggtatcggcgcatttggctat
atttacggcaccaagggtttccaggcgccggaagtccctacggaaggcccgtcggtctcc
agtgatatttacaccatcggccgcacgctcgcggcgctgacgttgaagctgccgcacgaa
gacggcgtgttcttgccggggattcccaaccccacccaggagccgcgtctgcgccggcac
gtgtctttctaccgcctgttgcagcgcgccacgaacccggatccgaagaagcgtttcaag
gacatcagcgagatgcgcacgcagctctacggggtgttgcgcgaaatcattgctatccgc
gatgggattcagcatccggcgcagcattcgttgttctcgccggcgcgttcgacgttcggc
accaagcacttggtgtttcgcacagaccagcttatcgatggcattgagcgcaccgtccgc
atcaccgcccccgaggtagtctccgcactgccgacgccgcttctagaccgagacgatgtg
ggtgccgcgttgctgcagggctattcctacaccgagccgcaggaagcgttggagacgctg
cgccaggcgatgcagacggtggagtatgaagaatccgccgagattccattcggcgttgtg
cgttccatgctggacttgggttacacgggccaggcgaagcagtggctggaaaagctcgag
tcccggctgggcgaagattggcgtttccagtggtattccggtgttacccagctgctgttg
gaagatttcacggcctcgcagctgcacttttctaacatgctggagattctgccgggcgag
gcggcaccaaagctggcgctagcagcggtcaatgagctgcttttgcagtcgatgggttac
tccgagcagcagcttctggagccagccgtggcacgcgcgtgtgcaaatattacgtccaac
ttgtacgagttggacgatgaatacttcgtggatcagaccatctgggagcacatttcctca
gacccgaagcgcatccgctttaactcgctgcgcctgtacggcacggtgtgggccaccaac
ccgacgacggtgtcctcagcctttggcctcgcgcgcctgctgcgcgcagaaaaccaggtg
gagatggccgtggcaacgcttgatcgcgtgcccaatgcctcgcgccaccagcgcatggcg
cggttgaccacgattgtgcagctgatttcccaagacgtcaacgaatcccgcgtgcgccgt
gccgcgcgccgcctggaagaaatcccgacgaatgaaccgcgctttttgcagatcaagatc
gcggtcatcaccgcgggcttaagcttcctgcgcgattccaagctgcaggcagccgcctcg
cctaatgacctgttcgagtacgcgttcacagagcgcggcctgcgctacggcctagccgat
acgctgcgcgcgcttgcccgccaggcaccatttagccgccaccgctacgcgctggtggac
ctggccaaccaggtccgcccggttacaacgttctag

DBGET integrated database retrieval system