KEGG   Chlorobium chlorochromatii: Cag_0967Help
Entry
Cag_0967          CDS       T00290                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cch  Chlorobium chlorochromatii
Brite
Enzymes [BR:cch01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cag_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABB28230
UniProt: Q3ARZ5
LinkDB All DBs
Position
1304764..1305360
Genome map
AA seq 198 aa AA seqDB search
MAYQQPPLPYADTALEPHISANTLSFHYGKHHVTYITNYNNLVAGTPFESMSLEEVIMQT
ANDAAKVAIFNNAAQAWNHTFYWNCLSPNGGGKPTGALADKIEADFGSFDKFKEELKNAA
VTQFGSGWAWLVLEGETLKIVKTGNAQTPLTSAQKPLLTIDVWEHAYYLDFQNRRPDYVS
AVIENLLNWEFAAANFAQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcagcaaccaccccttccttatgccgacacagctcttgaaccacatatttcg
gcaaacacccttagcttccattacggtaagcaccatgtaacctacattaccaactacaac
aatcttgttgcaggcactccttttgagagcatgagccttgaagaggtgattatgcaaacg
gcaaacgatgctgcaaaagttgccatttttaacaatgctgcacaagcatggaaccacact
ttttattggaactgtttaagccctaacggtggtggcaagccaacgggcgcattagccgat
aaaattgaggctgattttggtagcttcgataaatttaaagaggagttaaaaaatgcggca
gtaacgcaatttggtagtggatgggcttggttagtgcttgagggcgaaacgcttaaaatt
gtaaaaaccggcaatgctcaaactccactaacaagcgctcaaaagccacttttgacaatt
gatgtatgggaacacgcctattaccttgattttcaaaaccgtcgccccgattatgtaagt
gctgttattgaaaatctcctcaattgggaatttgctgctgcgaattttgcacaataa

DBGET integrated database retrieval system