KEGG   Chlorobium chlorochromatii: Cag_1685Help
Entry
Cag_1685          CDS       T00290                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cch  Chlorobium chlorochromatii
Pathway
cch00010  Glycolysis / Gluconeogenesis
cch00620  Pyruvate metabolism
cch00630  Glyoxylate and dicarboxylate metabolism
cch00640  Propanoate metabolism
cch00680  Methane metabolism
cch00720  Carbon fixation pathways in prokaryotes
cch01100  Metabolic pathways
cch01110  Biosynthesis of secondary metabolites
cch01120  Microbial metabolism in diverse environments
cch01130  Biosynthesis of antibiotics
cch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cag_1685
   00620 Pyruvate metabolism
    Cag_1685
   00630 Glyoxylate and dicarboxylate metabolism
    Cag_1685
   00640 Propanoate metabolism
    Cag_1685
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cag_1685
   00680 Methane metabolism
    Cag_1685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cch01004]
    Cag_1685
Enzymes [BR:cch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cag_1685
Lipid biosynthesis proteins [BR:cch01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cag_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB28937
UniProt: Q3APY8
LinkDB All DBs
Position
complement(2186616..2188616)
Genome map
AA seq 666 aa AA seqDB search
MATETPSSSQQEAAANPAEDSISSVLTEKRKFPPPASFSEQAHLSTMEQYEKLYADAAAD
PEGYWAGIAEQFHWFKKWDSVLEWNSPYAKWFNGGKTNICYNALDVHVKSWRKNKAAVIW
EGEQGDQRILTYGELHRQVCKFANVLKIAGIKPGDRIAIYMGMVPELMIAVLACARVGAV
HNVIFAGFSAHAITERVNDSRAKMVICADGTRRRGSTINLKNIVDEAIVNTPSVRNVIVL
KTTGETIKMHDGMDHWWHDLMGLAVDESEAVELDAEHPLFVLYTSGSTGKPKGILHTTAG
YMVHAASSFRYVFDIKDEDIYFCTADIGWITGHSYMVYGPLLNGATLLMYEGAPNYPQWD
RFWDIINRHKVTILYTAPTAIRAFIRAGNEWVTKHNLNSLRLLGTVGEPINPEAWMWYHK
VVGQEKCPIVDTWWQTETGGIMVSPMPGATPTKPGTATRPLPGIMVDVVHKDGTPCGANE
GGYLVIKKPWPSMLRTIYGDNERYEKTYWSEFKDMYFTGDGARKDDDGYIWIMGRVDDVV
NVSGHRLGTSEVESALVSHEAVAEAAVVSRPDDIKGNSLVAFVTLKDEYEGDMKLRESLR
NHVAREIGPIAKPDEIRWAKALPKTRSGKIMRRLLRELATSNEIKGDVTTLEDFGVLENL
RDQENE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaacaccatcatcaagccagcaagaggctgctgctaatcctgccgaggat
tccatcagttccgtgttaactgaaaaacgcaaatttccgcctcctgcaagcttttcagag
caagcgcacctttccactatggagcagtatgaaaagctttatgctgacgcagcggctgat
cctgaagggtattgggctggaattgctgaacaatttcactggtttaaaaaatgggactcg
gtacttgaatggaattcgccctatgcaaaatggtttaatggcggtaaaacgaacatttgt
tacaatgcgcttgatgttcatgttaaaagctggagaaaaaataaagccgcagttatttgg
gagggtgaacagggcgaccaacgtattttaacctatggtgaattacatcgtcaggtatgt
aagtttgccaatgtgttgaaaattgcaggcattaagccgggcgatcgtattgctatttac
atgggtatggtgcctgaacttatgattgctgtgctggcttgtgcgcgtgttggcgcggtg
cataacgttatttttgctggtttctcggctcatgctattacggagcgtgtgaatgattct
cgtgcaaaaatggtgatttgtgctgatggtactcgtcgtcgtggttcaaccatcaacctt
aaaaacattgttgatgaggcaattgttaataccccatcggtgcgcaatgtgattgtgcta
aaaactaccggtgaaaccattaagatgcacgatggtatggatcattggtggcacgattta
atgggacttgctgtagatgaatcggaagctgtggagttggatgctgaacatccgcttttt
gtgctttataccagcggttcaacgggtaagccaaaaggtattttacacaccacggcaggt
tacatggttcacgctgcaagctctttccgctatgtgttcgatattaaagatgaggatatt
tatttctgtacagccgacattggctggattacagggcatagctacatggtgtatggtccg
ctcttgaacggtgcaacgctgttgatgtacgaaggtgcaccaaactatcctcagtgggat
cgcttctgggatattattaatcgccataaggttaccattctctacacggctccaacggct
attcgtgcctttattcgtgctggtaacgaatgggtaaccaagcacaatcttaactctctc
cgcttgcttggtaccgtaggtgagccaattaaccccgaagcgtggatgtggtaccacaaa
gtggttggacaggaaaaatgccccattgtggatacgtggtggcaaacagaaacaggcggc
attatggtttctccaatgccgggtgcaacgccaaccaaaccaggcaccgcaactcgtcca
cttccaggcattatggtagatgttgtgcacaaagatggcacgccatgtggcgctaacgaa
ggtggttaccttgttattaaaaagccatggccttccatgttgcgtaccatttatggtgat
aacgagcgttacgaaaaaacctactggtcggagtttaaagatatgtactttactggcgat
ggtgcccgtaaggatgacgatggctatatttggatcatgggtcgtgttgacgatgtggta
aacgtttcggggcaccgccttggtaccagcgaagttgaaagcgctcttgtgtcgcacgaa
gcggtagctgaagcggctgtggtaagtcgtcctgacgatattaaaggtaactcgttggtt
gcctttgtaacgttaaaggatgagtatgagggcgatatgaagcttcgtgaatcgctccgc
aaccatgtggctcgcgaaattggacctattgctaagcccgatgaaattcgctgggcaaaa
gcgctgccaaaaactcgtagcggtaaaattatgcgccgcttgcttcgtgagcttgcaacc
agcaacgaaattaagggcgatgttactacgctcgaagattttggtgtgctcgaaaatctt
cgcgatcaagaaaacgaataa

DBGET integrated database retrieval system