KEGG   Caldicellulosiruptor changbaiensis: ELD05_07835Help
Entry
ELD05_07835       CDS       T05905                                 

Definition
(GenBank) flagellar hook protein FliD
  KO
K02407  flagellar hook-associated protein 2
Organism
ccha  Caldicellulosiruptor changbaiensis
Pathway
ccha02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:ccha00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ELD05_07835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ccha02035]
    ELD05_07835
Bacterial motility proteins [BR:ccha02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ELD05_07835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliD_C FliD_N UBN_AB DUF4176 Ribosomal_L1 PAS_11
Motif
Other DBs
NCBI-ProteinID: AZT90564
UniProt: A0A3T0D688
LinkDB All DBs
Position
complement(1591078..1592748)
Genome map
AA seq 556 aa AA seqDB search
MNISSTISTSYTSPYDAYKYYTRIGGLASGLDTDSIIQGLMSIQKARYNKLYQQQQLLQW
QREDYMNMANEIASFRDYVFDLRVSSSKFISMKAWGDAISGGYIDAAPTANSLVGDYQIK
VDQIATPAFMFVSKISSTDLANIQNSPEKAIWVYVNDDNAGNVSIDIKTSNPQDSKYIKI
DVSNLDVDGFERALASALKSTGKVDAYYDNVQGKLFIKRLQTGALTAFNLNSEISSIQKD
STMYSNGQNAKVSIKIGNVDYWKDQEFSQNTFTFLGTVITLKKETLVNGVFTYQSFAISK
DVDSTINNIKEFLSKYNDLIDKIYSKITERPNREFQPLTEEQKSQMKDDDIKKWEEAAKK
GLLYNDSILGSFLNNVRYWVYEKVDSLPEEINQLTDIGIETYSYFDGNKAGKLYIKDEEK
LRKALENDPNSVYKLFTASVGTLDDYKKTDPQTGKTYYDYNGYLLKQGLLQRIYYFSKDV
INKIYEKAGKPYFTSSYDPNSYIGKQLRYIATQMNAELDRLEKIEERYYKQFSLLESLMS
QMNAQSSWLSQQFSSK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaatataagctcaacgatctctacaagttatacaagcccttatgatgcatacaaatat
tacacaagaattggtggacttgcaagcgggcttgatacagattctataattcagggcttg
atgagcattcaaaaagcaaggtataacaaactgtatcaacagcagcagcttcttcagtgg
cagagagaagattatatgaatatggcaaatgagatagcaagttttagagattatgtcttt
gatttaagagtttcaagttctaaatttattagtatgaaagcttggggtgatgcaataagc
ggtggttatattgatgcagcacctactgcgaacagtttggtgggagattatcaaataaaa
gttgaccaaatagcaactcctgcttttatgtttgtttcaaaaattagtagtacagatttg
gctaacatacaaaatagtcctgaaaaagctatatgggtttatgttaatgatgataatgct
ggaaatgtctcaatagatataaagacttctaatccacaagatagtaagtatataaagatt
gatgtatcaaatttggatgttgatggttttgagagagctttagcatcagctcttaaatca
acaggaaaagttgatgcttattatgataatgtccaagggaaactttttataaaaagatta
caaacaggagctctcacagcatttaatttaaatagtgagataagtagtatacaaaaagat
tctacaatgtattccaatggacaaaatgcaaaagttagtataaaaattgggaatgtagat
tattggaaggaccaggaattttctcaaaatacatttacttttttgggaacagttattact
cttaaaaaagaaactttagtcaatggagtttttacgtatcagtcatttgcgatttcaaaa
gatgttgattctacaataaataatataaaagaatttctcagcaaatacaatgaccttatt
gataagatatatagcaaaataacagaaaggccaaatagagagtttcagcctttaacggaa
gagcaaaaatcccaaatgaaagatgatgacataaaaaaatgggaagaggcagctaaaaag
ggtttgctctacaacgattcgattttaggtagcttcttgaataatgtgaggtattgggtt
tatgaaaaagtggattcattaccagaagaaattaatcaactaactgatataggaattgaa
acatatagttattttgatggtaataaagcagggaaactctatataaaggatgaagaaaaa
ctgagaaaagcattagaaaatgatccgaatagtgtatataaattgtttactgcttccgtt
ggaacattagatgattataaaaagacagatccacaaacgggaaaaacgtattacgattat
aatggttacttattaaaacaaggtttgttacaaagaatatattatttttcaaaagacgtt
ataaataaaatttatgaaaaggcgggtaagccttattttaccagcagttatgatccgaac
agctacattggaaaacaattgagatatattgcaactcaaatgaatgctgagctggataga
ttagaaaaaattgaagaaagatattataagcagttttctctacttgaatcgctaatgtcc
caaatgaatgcacagagttcctggctttcccaacaatttagcagtaaataa

DBGET integrated database retrieval system