KEGG   Caldicellulosiruptor changbaiensis: ELD05_11055Help
Entry
ELD05_11055       CDS       T05905                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
ccha  Caldicellulosiruptor changbaiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 ADH_N_assoc 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AZT91127
UniProt: A0A3T0D7M4
LinkDB All DBs
Position
complement(2273290..2274264)
Genome map
AA seq 324 aa AA seqDB search
MRAAVFYGKKDLRVEEIDLPPLKEGEILVKIRACGICGTDVHIFNGEEGSAKVTPPIILG
HEFCGEVVETKSLLFKVGDKVSIDPNIYCGVCRFCRSGKVQLCESLTALGVNLNGGFAEY
AIVSEKQAILFEDIEFEEAALAEPLACCLHGIRKLEINPTDKVLVIGLGPIGLIMLEILK
LYGVYNIYGYEIDDFRKEIAKRQGIKEIIVEDTDEKFDIVIECAGTKESIEMAFEKLQKG
GQLLVFSVPSPKTNVLINPFEMFKKEARVYWSFVNPFTQKLAIELLRAKKISLKHIITHK
ISLEELSQALSKRYERQLKVIVQP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcggcggtattttatggcaaaaaagatttaagagttgaagagattgatttgcca
ccattaaaagaaggcgaaattttggtaaagatcagggcgtgtggaatatgtggaacagat
gtgcacatatttaatggcgaagaaggttcagcaaaggtcacaccaccgattattttaggg
catgagttttgtggtgaggtagttgaaacaaaaagcttactttttaaagtaggggacaaa
gtaagtattgacccgaacatttattgtggggtatgtagattttgcagaagtgggaaagta
caattgtgtgaaagtcttacagctttgggtgtaaacttaaatggtgggtttgcagagtat
gcgattgtatctgaaaaacaagcaatattgtttgaagatatagaatttgaggaagcagca
ttggcagaacctcttgcttgctgcctacatggaattagaaagcttgaaataaacccgaca
gataaggttctggtaattggccttgggccaattggccttattatgcttgagattttgaaa
ctttatggggtttacaatatctatggatatgagatagatgattttagaaaagaaattgca
aaaaggcagggtataaaggagataattgtggaggatacagatgaaaagtttgacattgta
attgagtgtgcaggaacaaaagagagtattgagatggcatttgaaaagcttcaaaaaggt
ggacaactactcgtattttctgtgccctcaccaaagacaaatgttttaataaatcccttt
gagatgtttaaaaaagaggcaagagtttattggtcatttgtaaacccgtttacccaaaaa
ttggcaattgaattacttagagcaaagaaaattagcttaaaacatataataacccacaaa
atttcattagaagagctttctcaggctcttagcaagaggtatgaaaggcaacttaaagtg
attgttcagccttga

DBGET integrated database retrieval system