KEGG   Clostridium chauvoei: BTM20_10075Help
Entry
BTM20_10075       CDS       T05083                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cchv  Clostridium chauvoei
Pathway
cchv00473  D-Alanine metabolism
cchv01100  Metabolic pathways
cchv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cchv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTM20_10075
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BTM20_10075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cchv01011]
    BTM20_10075
Enzymes [BR:cchv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTM20_10075
Peptidoglycan biosynthesis and degradation proteins [BR:cchv01011]
 Precursor biosynthesis
  Racemase
   BTM20_10075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATD55561
LinkDB All DBs
Position
2171399..2172556
Genome map
AA seq 385 aa AA seqDB search
MNLLHPFWAEINLDNFIYNINEIKSHIGNSKIIGIVKANAYGHGAVEISKTLLENGAETL
AVANIVEGIELREADIKAPIMILGVSEEFAIAAIINYDMEPTISSLEFANTLNNKAKESN
KTINIHIALDTGMGRIGFLPSSKSLEEIALISKLSNLKIKSTFSHFSTSDYKDKNYSNFQ
LKTYNDFISEIEKYNIPVGNRNLSNSAAIIDIPNAHFDNVRPGIIQYGYYPSDEVIKENF
NLKPVLTWKTNIVHIKEVNKGAFIGYGKTFETKRKSIIATIPVGYADGYSRGLSNKGKVI
INGQFAPIIGNVCMDQCMVDITDLKDVNLNDEVILLGSDNNIKFDADDMANLLGTINYEV
LCLIGRRAPRVYIKNNKVVTIKHFI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattacatccattttgggcagaaattaatttagataattttatatataacata
aatgaaataaaatcacatattggtaatagcaaaattataggtatagttaaagctaatgct
tatggtcatggtgctgttgaaatatctaaaactctattagaaaatggagctgaaactcta
gctgttgctaatattgttgaaggcatagaacttagggaagcagatataaaagctcctata
atgatacttggagttagtgaagaatttgcaatagctgcaattattaattatgatatggaa
cctactatatcttctttagaatttgctaataccctaaataataaggctaaagaaagcaat
aaaacaattaatattcatatagctttagatactggaatgggaagaataggctttttacct
tcttctaaaagtttagaagaaatagctttaatttctaagctttctaatttaaaaattaaa
agcactttttctcacttctctacttctgattataaagataaaaattattctaatttccaa
ttaaaaacttataatgattttataagtgaaattgaaaaatataatatacctgtaggaaat
agaaatttatctaatagcgctgctattatagatataccaaatgctcattttgataatgtt
cgtcctgggattattcaatatggatattatccttctgatgaagtaattaaagaaaacttt
aatttaaagcctgtattaacttggaaaactaatatagttcatattaaagaagttaataaa
ggagcttttataggatatggtaaaacttttgaaacaaaaagaaaaagtataatcgctact
atacctgttggatatgctgatggttactcaagaggtttgtctaataaaggaaaagtaatt
ataaatggtcaatttgctcctataataggaaatgtatgtatggatcaatgtatggtagat
ataactgacttaaaagatgtaaatttaaatgatgaagttattcttcttggaagtgataat
aacataaagtttgatgctgatgacatggctaatttactaggaactattaattatgaagtt
ctttgcttaatcggtagaagagctcctagagtttatattaaaaacaataaagttgtaact
attaagcattttatttaa

DBGET integrated database retrieval system