KEGG   Coprinopsis cinerea: CC1G_04239Help
Entry
CC1G_04239        CDS       T01275                                 

Definition
(RefSeq) hypothetical protein
Organism
cci  Coprinopsis cinerea
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2418
Motif
Other DBs
NCBI-GeneID: 6009756
NCBI-ProteinID: XP_001833260
UniProt: A8NFE0
LinkDB All DBs
Position
2
AA seq 374 aa AA seqDB search
MALRRLAQNNAAAATPKREADSPVAKPRLSMPTTPRNRVSIGPYRSPASTPSLSATIPFD
WEAARSRAPPPYTPLQRKLRQSTAGDSTDSPRPVRRAFVRKKGFFEKLRDTPSNVAFYLS
MFPQNLPLPSAKASSRILAGIMHLAQFSLRVSKARRSPSNWEDIYGDDDDAWFDWTSLLT
VILLGAAFANAAYLLSRTRKYHFHRRVDPISSPNAKFVPKDWDTAQPLRRPLWRRSLSFS
WWAFISSWRFLLNIPSPPPAPANAGPASKIQELEVWTPNELELQLFSLYSPVHALLWQAT
SSANWITMLFCMGLLTITLNVLIFQYQMLVKDKEAIAAEVMSEYNEGFVYPRINPIRHDV
GVMTHESEIVSVWD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcccttcgtcgcttagcccagaacaacgcagcggcagccaccccaaagcgggaggcc
gactccccagtcgcaaagccaaggctatcgatgccgacaaccccaagaaacagagtctct
ataggcccatatcggtccccagcctcgactccatctctgtctgccacgattccctttgac
tgggaagccgctcgttctcgtgcaccaccaccgtatacaccacttcagcgcaaactcaga
caaagtaccgccggagactcgactgacagtcctcgtccagttaggcgcgcttttgtacga
aagaaaggtttctttgaaaaactccgggatacaccatccaatgtcgcgttttatctatcc
atgttccctcaaaatcttccacttccttcggcaaaggcttcctcgaggatcttggccggg
atcatgcacctcgctcaattttctttacgtgtgagcaaagcacgccgatcacccagtaac
tgggaggatatctacggcgacgacgacgatgcatggttcgattggacctcgttgttgacc
gtcatcctcctcggtgctgctttcgccaatgcagcatacctcttgtcccgtacacgaaag
tatcactttcatcgccgggtcgaccccatctcttcgcccaacgcgaaatttgtgcccaag
gactgggacactgctcagccactccgtcggccactgtggagacgatccctgtcgttttcc
tggtgggcgtttatcagctcatggaggttcctcctgaacattccttcgccaccgcctgca
cctgctaacgcaggacccgcatccaagatccaagaattggaagtctggactccgaatgaa
ctcgaactgcagctctttagcttgtattcacctgtacatgctttgctatggcaggccacg
tcctctgccaactggataaccatgctcttctgcatgggactgttaaccatcacgctcaat
gtcctcatcttccagtatcaaatgttggtaaaagacaaggaagctattgctgcggaggtc
atgagcgagtacaacgaaggatttgtttacccaaggataaaccctatccgacacgacgtc
ggtgtaatgacccacgaatcagagatcgtcagtgtttgggattag

DBGET integrated database retrieval system