KEGG   Coprinopsis cinerea: CC1G_04876Help
Entry
CC1G_04876        CDS       T01275                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cci  Coprinopsis cinerea
Pathway
cci00052  Galactose metabolism
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CC1G_04876
   00500 Starch and sucrose metabolism
    CC1G_04876
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CC1G_04876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 6017691
NCBI-ProteinID: XP_001841032
UniProt: A8PFW6
LinkDB All DBs
Position
2
AA seq 932 aa AA seqDB search
MRLRTTVPIALSSALWLTKSRAAYVAPEVLDACPGYVAKQATYSHGGSEAQIDLTLASSP
GCNVFGQDIENLRVTVAYETGKFITFQDRLHVKITDANNERYEVPEDVFPRPPNRRILPE
RSNLVFNYTSDPEPFYLTVSRRSTGEVLFSTKDHPLIFEDQYLRVKTDLPAGANIYGFGE
HTETFRLDANNYGRGMVRTLWSRDSYGVPNGTNLYGNHPVYFEHRTTGTHGVFLLNSNGM
DVKLNETATGTSLEYNVIGGVLDFYFLAGSESNPEALAKQYAEVSGLAPLFPYWGLGLHQ
CRFGYKNYVEVASVIARYREAGIPLETMWTDIDYMDRRLIFTLDPQYFPLNRMREIVSHL
HENKQHFIVMTDPAVGVLPDESYPPFERGEELGVWLKNRDGSNHLGLVWPGVTVFPDWFH
PNVEQYWNGEFERFYNAEDGLNIDGAWIDMNEPASFCDYPCLDPWGEAIKQNLPPPRDQE
PPAPDAPIFVEGSTDWYAPIQTSAPGVSSNVIEESSSTLERRQTSDDEHLLNPPYAIDNE
FGPISSRTAYTNIIHANGLSEYDTHNLYGSMMSTFTRKAMINRRPGRRPFIITRSTFAGA
GRDVGKWLGDNVSSWEHYRMSIASMLNFAAIFNMPLVGSDVCGFVGDTTEELCARWALVG
AFNPFFRNHNGENHVSQEFYVWPKTAEAARAAIDIRYRLLDYLYTGLYQAHLDGTPVLSP
VWYKFPKDTETFPIDLQFFYGAHILVSPVTEEGSTSVTYYLPADTWYDFFTLAPVTRTGW
VTQHRVSHAQIPMHIRGGAVLPLRSEMAMTTAELRTKPFDIVVAPDARGNASGSLYIDDG
ETIDPSPSDVTNVEFSYRNRRLRVSGRFGYKIERGVQWRTVKFAGVDRQPLMVLVNGFPI
IQRERIRYDRRQKTLEVDVNLSRFAGFEVVLV
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcgtacaacggtccccatcgctctctcctctgccttatggctgacgaagtct
cgtgcggcttatgtcgctcccgaggtcctcgatgcctgcccaggctacgtcgccaagcag
gccacctattctcatggtggaagcgaggctcagattgaccttactctggccagctctcct
ggttgcaatgtcttcggtcaggacatcgagaacctgcgcgtcaccgtcgcttacgagact
ggcaagttcattacattccaggatcgtcttcatgtcaagattaccgacgccaacaatgag
cgctatgaggtccccgaagacgtcttccctcgcccacccaaccgccgcatcctccccgag
cgatccaaccttgtcttcaactacacttccgacccagagcccttctacctcactgtctct
cgtcgctcgactggtgaagtcctcttctccaccaaggaccaccccttgatcttcgaagac
caatacctccgagtcaagaccgatctcccagccggtgccaacatctacggtttcggtgag
cacactgagaccttccgtctcgatgcaaacaactatggtcgtggcatggtccgcaccctc
tggagccgcgactcctacggtgtccccaatggcaccaacctttacggaaaccaccccgtc
tatttcgagcatcgtaccactggtactcacggtgtcttcctcctcaactccaacggcatg
gacgtcaagctcaacgagaccgccaccggcacctctcttgagtacaacgttatcggtggt
gttctcgacttctatttcttggctggtagtgagagcaaccctgaggctcttgccaagcag
tatgccgaggtttctggtttggctcccctcttcccttactggggtctcggtttgcaccag
tgccgatttggctacaagaactacgttgaggttgccagtgttatcgctcgatacagggag
gccggtatccctctcgagaccatgtggaccgatatcgactacatggacaggcgtctcatc
ttcacattggaccctcaatacttccccttgaaccgtatgcgcgagatcgtctctcacctc
cacgagaacaagcaacacttcatcgtcatgaccgaccctgcagtgggcgttcttccggac
gagtcctatcctcccttcgagcgtggcgaggagctcggagtctggctcaagaaccgagac
ggatctaaccaccttggactcgtatggcccggtgtcaccgtcttccccgattggttccac
cctaacgttgagcagtactggaatggcgagttcgagcgcttctacaatgccgaggacggc
ttgaacatcgatggagcatggatcgacatgaacgagcccgccagcttctgcgactacccc
tgcctcgacccctggggtgaagccatcaagcagaaccttcctcctccccgtgaccaagag
ccccccgcccctgacgcacccatcttcgttgaaggcagcactgactggtatgccccgatc
cagaccagcgcgcctggtgtctcttccaacgtcatcgaagaatcttccagcaccctcgag
cgccgccagacctccgacgacgagcacctcttgaaccctccctatgccatcgacaacgag
ttcggccccatctcctcccgcactgcctacaccaacatcattcacgccaacggtctctcc
gagtacgacacccacaacttgtacggcagcatgatgtccaccttcacccgcaaggctatg
atcaacaggcgccccggacgccgccccttcatcatcactcgttcgacctttgctggtgcc
ggacgcgatgttggcaagtggctcggtgacaacgttagctcttgggagcactaccgcatg
agcattgcctccatgctcaactttgctgccatcttcaacatgcctttggtcggaagcgat
gtctgcggcttcgtcggcgataccactgaggagctctgtgctcgatgggccctcgttggt
gctttcaaccccttcttccgcaaccacaacggtgagaaccacgtcagccaagagttctat
gtctggcccaagacggctgaggctgccagggctgccatcgacattcgataccgcctcctt
gactacctctacactggcctctaccaggctcacctcgacggtaccccagttctctccccc
gtctggtacaagttccccaaggacaccgagaccttccccatcgacctccaattcttctac
ggcgcccacatcctcgtctcccccgtcaccgaggaaggctccacctcggtcacctactac
ctccccgccgacacctggtacgacttcttcacgctcgcccccgtcacccgcaccggctgg
gtcacccagcaccgcgtctcgcacgcccagatccccatgcacatccgcggtggcgccgtc
ctccctctccgctccgagatggccatgaccaccgccgagctgcgcaccaagcccttcgac
atcgtcgtcgcccccgatgcccgtggcaacgcctctggctcgctctacatcgacgatggc
gagactatcgaccccagcccgtctgatgtcaccaacgtcgagttctcgtaccgcaaccgc
cgcctcagggtttccggccgcttcggatacaagattgagcgtggtgtgcagtggaggact
gtcaagtttgctggtgttgataggcagcctcttatggtcctcgtcaacggtttcccaatc
atccagagggagaggatcaggtacgacaggaggcagaagactttggaggttgatgtcaac
ctctcgaggtttgctggcttcgaggtcgtcttggtctaa

DBGET integrated database retrieval system