KEGG   Coprinopsis cinerea: CC1G_04997Help
Entry
CC1G_04997        CDS       T01275                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cci  Coprinopsis cinerea
Pathway
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_04997
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CC1G_04997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 6012544
NCBI-ProteinID: XP_001836004
UniProt: A8NSG1
LinkDB All DBs
Position
8
AA seq 581 aa AA seqDB search
MRSLLFTTFLGLFSTVTNARSDPIAIADAYFERQVPIATENLLANIGPDGARSSGALPGV
VIASPSTEDPDYLYTWTRDASLVMKNVIDRYLRDEDDSLQSIVEDFIPAQAYLQQLDNPS
GNVTTGGLGEPKFNIDLTPFTGSWGRPQRDGPPLRAIAIIRYANHLLDTGKPFVVLEFVW
PVIKLDLDYTAKYWNTTGFDLWEEVSSSSFFTSAIQHRALMEGAAFASRIGQPDLARSYF
KQADNILCFLQACVSYWNPSEGFITSNTGGGRTGIDANSILGSIHTFDPAAGCDPVTFQP
CSDKALSNLKVYVDAFRSIYPINYGTPTNQAVATGRYAEDVYYGGHPWYLTTAAAAQQLY
DALMVWDMQGYLKVSSISLAFFRQFDDSVQPGTYSNSSETYRILKNAVRWFADEFIEVIA
RYTPEDGSLAEQFHRETGEPLSAKHLTWSYASILTADAARSGVIPRSWGASGLEVPSKCE
SNAVPMSSVTFSVKAQTSWGENIFLTGSIDALKNWSPDNALALSSSDYPIWKVTVEIPVD
TRFEYKYIRKLGDGSVIWESDPNRSNSSPGSGSKTIDDSWR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttactcttcacgacgttcctaggcctcttttcgactgtaacaaacgccaga
tccgaccccatagccatcgccgacgcctactttgaaaggcaggttccaatcgccaccgag
aatttgctggcgaatattggacccgacggtgcgaggtcttcaggcgctttgccgggagtc
gtaatcgcaagccccagcactgaagatccggactatctctacacatggacgagggacgct
tcgttggttatgaagaacgtcatcgacagatatcttcgggacgaggacgactccctccaa
tcgatagttgaggacttcattccagcccaagcgtaccttcagcaactagacaaccccagt
ggaaacgtcacgaccggaggattgggggaaccgaaatttaacatcgatttgacgccattc
actggtagctggggaaggcctcagagggacggccctcctcttcgcgctatcgcgattata
cgctacgcaaatcacctacttgacaccgggaagccattcgtagttctggaattcgtatgg
cctgtcattaagctggacctcgactatactgcaaagtattggaacacgacaggtttcgac
ctctgggaagaagtatcttcaagttcattcttcacgtctgccatccagcatcgcgccctc
atggaaggtgccgctttcgcaagtcggatcggacagcccgacctagcgcgatcctacttc
aaacaggccgacaacattctctgtttcctccaggcatgtgtatcgtattggaatccttct
gaaggcttcatcacctcgaatacgggaggtggccgaaccggaatcgatgccaactctatc
ttaggatcgattcatactttcgacccggccgctggatgcgacccggtcaccttccagcca
tgctccgacaaggcgttatccaacctcaaggtttacgtcgacgccttccggtcgatctac
cctatcaactatggcactcccaccaatcaggccgtggcaactggccgctatgctgaagac
gtctactacggtggtcatccgtggtacttgactactgcagccgccgctcagcaactgtac
gatgccctgatggtttgggatatgcaaggctacctcaaagtctcatcaatatctctggcc
ttcttccggcagttcgacgattccgttcaaccaggaacctactcaaactcttcagagacg
tacaggatccttaagaacgccgtcagatggttcgccgatgaattcattgaagtcatcgcc
aggtacaccccagaagacggaagtttggccgagcagtttcatcgggagactggcgagcct
cttagcgccaaacacttgacatggagctatgcgtccatcctaactgctgacgctgctcgg
tcgggtgtcatccctcggagctggggagctagtggcttggaggttccttcgaaatgcgaa
agtaacgctgtcccgatgtcgagcgtcacgttcagcgtgaaggcacagacctcatgggga
gaaaacatcttcctgaccggttctatcgacgctctgaagaactggtccccagacaacgcc
ctggcactttcttcatcggactatcccatctggaaggtcaccgtcgagatacctgttgac
acgagattcgagtacaagtacattcgcaagttaggggatgggagcgtgatttgggagtcg
gatcccaatcggtcgaactcgagccctgggtctgggtccaagacgattgatgattcgtgg
aggtag

DBGET integrated database retrieval system