KEGG   Coprinopsis cinerea: CC1G_05144Help
Entry
CC1G_05144        CDS       T01275                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cci  Coprinopsis cinerea
Pathway
cci00500  Starch and sucrose metabolism
cci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1G_05144
Enzymes [BR:cci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CC1G_05144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase JIP_LZII
Motif
Other DBs
NCBI-GeneID: 6009940
NCBI-ProteinID: XP_001833444
UniProt: A8NG05
LinkDB All DBs
Position
2
AA seq 526 aa AA seqDB search
MLSFTNLYFLIAFATLGYAATADEWRSRSIYQLLTDRFALPPGTEPIECDTGRQTFCGGT
WNGIRDRLDYIQNAGFTAIWISPVHKNYEGPRTPYGDPYHGYWVTDITQLNSKFGTSEDL
HALVDDLHKRGMYLMVDIVVNHVMTTSTTPDYENSEFFFKDASFYHPYCPIDYSNSTSEQ
VCWMGDEQVPLADVDTTNPTVIQRYGEWIEAFVKEYKIDGLRIDAAKHVQADFWPDFCGK
AGVFCMGEVFGGAEVDPVAQWQGPLDSVLNFPMYSAIRDAYVIPGPANVTGLDLTLVGNF
LENHDVPRWHNLSVDPQSLYNAMAWNFMTEGIPVVYYGQEHGFSGLGDPHNREALWPSGY
ANSTAYEYITMLNMLRNHLIKTTDWLQQETTILTSGPHGVAFIKGSVISILTTIGSPPQV
GTHISAKTPYASQTPLTNVVTCQQWVVGAGGSVDAQYSLGGVPVILVPSSQLKGSGLCGE
ELVEIDEAGGRADPLKGSASGLLASRPGLPVTALTAFTFLFAMLSS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatttacaaacctatactttttaatcgcctttgcaactttgggatacgctgcc
actgctgatgagtggagaagtcgttccatctaccaacttcttacagatcgcttcgccctg
cctccgggaactgaacccatcgagtgtgacacagggaggcaaacgttctgcgggggaacc
tggaatggaatccgcgaccgtcttgattacatccagaatgccggtttcacggcgatctgg
ataagccccgtccacaaaaactatgaaggaccgcgaacaccttacggtgatccataccat
ggctattgggtcacagatatcacacagctcaacagcaagtttggtacatccgaggacctc
catgctctcgtcgacgacctgcacaagcgtggcatgtacctgatggttgatattgtagtc
aaccacgtcatgaccacttcgacgacacccgactacgagaactctgaattcttctttaag
gacgcttcattctatcatccctattgtcccatcgactacagcaactcgacaagcgaacaa
gtatgttggatgggagacgagcaggtacccctcgcggacgtcgacactaccaatccaaca
gtcattcaacgttatggagaatggatcgaagcgttcgtcaaggagtacaagattgatggt
ttacgtatcgatgccgcaaaacacgtccaggctgacttttggcccgacttttgcggcaag
gctggcgttttctgcatgggcgaggtcttcggtggagctgaagtggaccctgttgcgcaa
tggcaaggtccattagactctgtgctcaacttccccatgtactcggctattcgagatgca
tacgttattcctggcccagccaatgtgactggtctcgatttgaccctggttgggaacttc
ctggaaaaccacgacgttcctcgatggcacaacttgtctgtggacccccagagtctatat
aatgccatggcttggaattttatgacggagggtattcctgtggtctactatggtcaagag
cacggtttcagcggcctcggcgatcctcacaaccgtgaggcactctggcccagcggttat
gccaattccaccgcctacgaatatatcaccatgctcaacatgcttcgcaatcacctcatc
aaaactacggactggcttcaacaagagacgacaattctcacttctggtcctcatggtgta
gcattcatcaaggggtctgtgatttctatcttgacgaccatcggttctcccccccaagtc
ggtacccacatctctgcgaagacgccatatgcttctcagacgcctcttaccaacgtggtc
acttgccaacagtgggtggtaggagccggtggttccgttgacgcccagtattctctcggt
ggtgtccccgtcattctggtaccaagcagccaactcaaaggatcgggactatgtggcgag
gagttggtcgagatcgacgaagctggtggccgggctgaccctttgaaaggctctgcttct
gggttgcttgctagtcgacctggcctccctgtgactgctctaactgcttttacattcctc
ttcgcgatgcttagttcttaa

DBGET integrated database retrieval system