KEGG   Coprinopsis cinerea: CC1G_06084Help
Entry
CC1G_06084        CDS       T01275                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cci  Coprinopsis cinerea
Pathway
cci00020  Citrate cycle (TCA cycle)
cci00190  Oxidative phosphorylation
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
Module
cci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cci_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC1G_06084
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CC1G_06084
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CC1G_06084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 6016517
NCBI-ProteinID: XP_001839894
UniProt: A8PA35
LinkDB All DBs
Position
2
AA seq 638 aa AA seqDB search
MLAARSVRRSLLGHARAFHASSKVSRVVATNPVKAQEVKGWGKYPLIEHEYDAVVVGAGG
AGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPNTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHAILHTLYGQSLRHDTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPQQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSHL
PPDILHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGNDK
VVPGLYAAGEAASVSVHGANRLGANSLLDIVVFGRAVAHHIRDTWTPGKPHKTIPEESGL
ESIEFLDKIRRADGPEPTAKIRLDLQKAMQADAAVFRTQESLDEGVEKVREIYNNFKNVG
IKDRSMIWNSDLVETLELRNLLQCAIQTIVSAAARKESRGAHAREDYPERDDENWMKHTL
SYQPDVESPDVKLAYRRVIETTLDENECKPVPPFKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgcaaggtctgtgcgacgctctcttttgggccatgcccgtgcattccacgct
tcttccaaagtatcccgcgtcgtcgcgaccaaccctgtaaaggctcaggaggtcaagggc
tggggtaaatacccgctcatcgagcacgaatacgatgctgtcgttgtcggtgctggaggc
gctggtttgcgagctgcctttggtctcgctgaagccggcttcaagaccgcctgtatcacc
aagcttttccccaccagaagtcacaccgtcgctgcccagggtggtatcaatgctgcactc
ggaaacatgactgaggacgactggcggtggcacatgtacgacacggttaaaggctccgac
tggctcggtgaccaagatgccatccactacatgtgcagagaagctcccaacactgtcatt
gagcttgagcacttcggtgtgccattctcaagaacgaaagagggcaagatctaccagcgt
gcgttcggtggtcagtcgttgaagttcggcaagggtggccaggcctaccgttgcgctgct
gccgctgacagaaccggccacgccattctccacactctttacggtcaatctctccgacac
gacaccaacttcttcatcgagtacttcgccctcgacctcattatgcaagatggcgagtgc
gtcggtgtcatcgccttgaacatggaagacggaaccctccaccgattccgtgcccacaag
accgtcctcgccactggcggttacggacgagcctacttcagctgcactagcgctcacact
tgctctggtgacggtaacgccatggttgcccgtgccggccttccccagcaggatctcgaa
ttcgtccagttccaccctactggtatctacggtgctggctgcttgatcactgagggttct
cgtggtgagggaggatacctcctcaactcggagggtgaacgtttcatggaacgatatgcc
cccaccgctaaggatcttgcttctcgtgacgtcgtctcccgatcaatgaccattgagatc
cgtgagggccgtggtgttggtcctgagaaggatcacatctacctccaactcagccatctc
cctcccgacattctccatgagcgattgcccggtatctctgagaccgccgccattttcgct
ggtgtcgatgtcaccaaggagcccatccctgtcctccccaccgtccactacaacatgggt
ggtattcctactcgatacaccggtgaggtcatcaccgttgacgagaacggcaacgacaag
gtcgtccctggtctctacgccgccggtgaagccgcctccgtctccgtccacggtgccaac
cgtctcggcgccaactccctcctcgacatcgtcgtcttcggccgtgccgtcgcccaccac
atccgtgacacctggactcccggcaagccccacaagaccatccccgaggagtctggtctc
gagagcatcgaattcctcgacaagatcaggcgcgctgacggacctgagcctactgccaag
attcgtctcgacttgcagaaggctatgcaggctgatgctgctgtcttccgtacccaggag
tctttggatgagggtgttgagaaggttagggagatttacaacaactttaagaatgttgga
atcaaggatcgttctatgatctggaactctgacttggttgagacgctcgagttgcgcaac
cttctccagtgcgctattcagactattgtctccgctgctgcccgtaaggagtcccgaggt
gcccatgctcgtgaggactacccagagcgtgacgacgagaactggatgaagcacacgctc
tcgtatcaacctgatgttgagagccctgatgtcaagcttgcctaccgacgtgttattgag
accactcttgacgagaacgagtgcaagcctgtgcctcctttcaagcgtgtttactaa

DBGET integrated database retrieval system