KEGG   Coprinopsis cinerea: CC1G_06890Help
Entry
CC1G_06890        CDS       T01275                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cci  Coprinopsis cinerea
Pathway
cci00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CC1G_06890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cci02000]
    CC1G_06890
Enzymes [BR:cci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CC1G_06890
Transporters [BR:cci02000]
 Other Transporters
  Pores ion channels [TC:1]
   CC1G_06890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C_5 GST_C GST_C_3 IL23
Motif
Other DBs
NCBI-GeneID: 6007069
NCBI-ProteinID: XP_001830624
UniProt: A8N718
LinkDB All DBs
Position
3
AA seq 255 aa AA seqDB search
MAIPDAQIHPVATGAAAALVEAHQAPQELVFYAGWFCPFVQRTWIALEEKKVPYQYKEVN
PYKKEPEFLAINPKGLVPALAYKGRALYESLILCEFLEDAFPNHTKLLPDDPVEKAHARI
WIDHLSKTYVPASHRLLQAQTPEKVKEGRDEVVDSLRKFSEQIRGPFFLGETFSLVDVAV
APWIARDYILREHRGFDRKDVGPKWEEYAKLIESRPSVVQTSSDREHLDVIYGRYLRDEA
QSEAAKAIRAGRVIP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctattcctgacgctcaaattcatcccgttgctactggcgctgctgccgccttggta
gaagcgcaccaagcccctcaagagttggtcttttatgctggatggttctgcccattcgtt
cagcgaacttggattgctttggaagagaagaaagttccttatcagtacaaagaagtcaat
ccttacaagaaggaaccagagttcctcgcaatcaaccccaaaggcctcgttccggcactc
gcatacaagggaagggcattgtacgagtccctcatcctgtgtgaattccttgaggacgcc
ttcccaaaccacaccaaactcctcccagatgaccctgtcgaaaaggcacacgcccgaatc
tggatagatcacctctccaagacctatgtccccgcctcacatcgcctcttgcaagcccag
acacccgagaaagtcaaagaagggcgcgatgaagtggttgattctctccgcaagtttagt
gagcaaatcaggggcccgttcttccttggtgaaacgtttagcctggttgatgtggctgtt
gcgccttggattgcgagggactatattctgagggagcatcggggctttgataggaaggac
gttggaccaaagtgggaggagtatgccaagttgattgagagcaggccgtcggtggtccag
acttctagcgatcgggaacatctcgatgtaatctatggtcgctacttgcgtgacgaggcg
cagagcgaggctgccaaagccatccgagctggtcgcgtcattccttga

DBGET integrated database retrieval system