KEGG   Coprinopsis cinerea: CC1G_08664Help
Entry
CC1G_08664        CDS       T01275                                 

Definition
(RefSeq) transaminase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cci  Coprinopsis cinerea
Pathway
cci00220  Arginine biosynthesis
cci00250  Alanine, aspartate and glutamate metabolism
cci01100  Metabolic pathways
cci01200  Carbon metabolism
cci01210  2-Oxocarboxylic acid metabolism
cci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CC1G_08664
   00220 Arginine biosynthesis
    CC1G_08664
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cci01007]
    CC1G_08664
Enzymes [BR:cci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CC1G_08664
Amino acid related enzymes [BR:cci01007]
 Aminotransferase (transaminase)
  Class I
   CC1G_08664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 6014211
NCBI-ProteinID: XP_001837651
UniProt: A8NZD0
LinkDB All DBs
Position
6
AA seq 477 aa AA seqDB search
MRPLTIDSLNPAILKVEYAVRGELAIKAEKYRVQLQDKDNHGLPFDRVISSNIGNPQQKG
LDQPPITFNRQVAALMEYPALAELAPNAFPKDVIARAKELYAEIGSIGAYSHSQGVPFIR
KSVAQFIQERDGYPADPNHIFLTAGASAGVSLLINMLISSPTSGILIPIPQYPLYTATLA
QHHGVPIPYYLDESQGWGTSVDSIEAALEKAHKNNVVPKALVIINPGNPTGALLDEATQI
KLVHLCEKYSLVLLADEVYQSNLHKPDQHPFTSFKKVVRKLDSHVPLVSFHSISKGVTGE
CGRRGGYFECVNISEPIIALMYKMVSVGLCPPLAGQIGVDCMIRPPKPGDESYELWKKET
DTIHEALRTRTSIMAERLNALPGVSCVDSPGALYLYPQITLSKKAQEAARAAGKEPDAFY
ALELLDATGICVVPGSGFGQKENEWHYRLTCLCPGVDEYVGKLEKFHLSFIEKWGLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccctcactatcgactctctcaacccagcaatcctcaaggtcgagtacgccgtc
cgcggtgagctcgccatcaaggcagagaagtacagagtccagctccaggacaaggacaac
catggcctcccctttgacagggtcatctcctccaacatcggtaacccacagcagaagggc
cttgaccagcccccaatcaccttcaaccgccaggtcgctgccctcatggagtaccctgct
cttgccgagctcgcccccaatgcgttccccaaggacgtgattgcccgtgcaaaggagctc
tacgctgagattggctccattggcgcgtactctcatagccagggtgtcccctttatccgc
aaatccgtcgctcagttcattcaagaacgagacgggtatcctgccgatcccaaccacatc
ttcctcactgcaggagcttccgcaggcgtatcgctcctgatcaacatgctgatttcatcg
cctacttccggaattctcattccgatcccccagtatcccctttataccgccaccctcgct
cagcaccatggtgttcctatcccctactacctagacgaatcccagggctggggcacttct
gtcgactccatcgaggctgccctcgaaaaggcacacaagaacaacgtcgtccccaaggcc
ctagtcatcatcaaccccggtaacccgaccggtgcactcctagacgaagccacccaaatc
aaactagtccatctctgcgagaaatactcactcgtccttctcgcggacgaagtctaccaa
tccaacctccataaacccgaccagcacccctttacctcgttcaagaaggtcgtccgcaag
ctcgactcacatgtccccctcgtttccttccattccatttccaaaggcgttacaggcgaa
tgtggacgcagaggaggctactttgaatgcgtcaacatctccgaacccatcatcgctctt
atgtacaagatggtctcggtcggactttgccctccgctcgcgggccaaattggcgttgat
tgcatgattcgccctcctaaaccaggcgacgagagctacgagctctggaagaaggagact
gataccattcacgaggcattgaggacccggaccagcatcatggccgagcggctcaacgcg
cttccgggcgtttcctgcgtcgattcaccaggtgctctctacctctatccccaaatcacg
ttgtccaagaaagcacaggaggctgcccgtgctgccggaaaggagcctgatgcattctac
gccctcgaactattggatgccactggtatctgcgtggtcccgggaagtggctttgggcaa
aaggagaacgagtggcactaccgcttgacctgcctctgcccaggcgtggatgagtacgtg
ggcaagcttgaaaagttccacctctccttcatcgagaaatggggccttgagtga

DBGET integrated database retrieval system