KEGG   Coprinopsis cinerea: CC1G_11465Help
Entry
CC1G_11465        CDS       T01275                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cci  Coprinopsis cinerea
Pathway
cci00020  Citrate cycle (TCA cycle)
cci00480  Glutathione metabolism
cci01100  Metabolic pathways
cci01110  Biosynthesis of secondary metabolites
cci01130  Biosynthesis of antibiotics
cci01200  Carbon metabolism
cci01210  2-Oxocarboxylic acid metabolism
cci01230  Biosynthesis of amino acids
cci04146  Peroxisome
Module
cci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cci_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC1G_11465
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CC1G_11465
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CC1G_11465
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CC1G_11465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 6014382
NCBI-ProteinID: XP_001837820
UniProt: A8P046
LinkDB All DBs
Position
6
AA seq 418 aa AA seqDB search
MSSTAFKKIVVQNPVVELDGDEMTRIIWKKIREELILPYLQLDIKYFDLGLEYRDQTNDQ
VTIDAANAILKHQVGIKCATITPDEARVEEFKLKEMWKSPNGTIRNILGGTVFREPIILE
RIPKPIPGWVKPIVIGRHAFGDQYRSTDYVVPGAGSLKLVYSPADGSAPVELPVYDFKGP
GVAMSMYNTDESIIGFAHSSFKMAIAKKMPLFMSTKNTILKRYDGRFKDIFQEIYDTTYK
AEFEALGIYYEHRLIDDMVAQAVKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELL
TPDGKIIESEAAHGTVTRHYREYQKGNETSTNPVASIFAWTRGLLHRAKLDNNAELKAFC
EDLEAACVEVIDQDGIMTKDLALAIHGKNMKREHWVVTNDYMDAVNAKLQKKLAARQQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaccgccttcaagaagatcgtcgtccagaaccccgtcgtcgagctcgacgga
gatgagatgaccaggatcatctggaagaagattcgtgaggagcttattcttccctacctc
caactcgacatcaagtactttgacttgggtttggaataccgggaccagaccaacgaccaa
gtcaccatcgatgccgccaacgctattctcaagcaccaagtcggtatcaagtgcgctacc
atcactcccgatgaggcccgcgtcgaagagttcaagttgaaggagatgtggaagagcccc
aacggcacaattcgaaacatccttggaggaactgtattccgggagcctatcatcctcgaa
cgcatccccaagccaattcccggatgggtcaagcccatcgtcattggacgacatgctttc
ggtgatcagtaccgatccacggactatgtcgttccaggcgctggaagcctcaagctcgtc
tacagtcccgcagatggatctgcccccgttgaactccccgtctatgacttcaagggccct
ggtgttgccatgagcatgtacaacactgatgagtctatcatcggattcgcccattcgtcc
ttcaagatggccattgccaagaagatgcctctcttcatgtcaaccaagaatactatcctc
aagcgatatgatggccgcttcaaggatatcttccaagaaatctatgataccacctacaag
gccgaattcgaggctctcggcatctactacgagcaccgactcattgacgacatggtcgcc
caagcagtcaagtcctccggcggcttcgtctgggcctgcaaaaactacgacggtgacgtc
caatccgacatcctcgcccaaggcttcggctccctgggcatgatgacctccgagctcctc
acccccgacggcaagatcatcgagagtgaagccgctcacggaaccgtcacccgtcactac
cgtgaataccaaaagggcaacgagacctcaacaaaccccgtcgcctctatcttcgcctgg
acgaggggtctgctacacagggccaagctcgacaacaatgctgagctcaaggccttctgc
gaggaccttgaggcggcgtgcgtggaggtcattgaccaggatggcatcatgaccaaggat
ctggctcttgctatccacggaaagaacatgaagagggagcactgggttgtcaccaacgac
tacatggatgctgttaacgctaagctgcagaagaagttggccgcccgccagcaatag

DBGET integrated database retrieval system