KEGG   Corynebacterium camporealensis: UL81_01165Help
Entry
UL81_01165        CDS       T03923                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00020  Citrate cycle (TCA cycle)
ccj00190  Oxidative phosphorylation
ccj00650  Butanoate metabolism
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01120  Microbial metabolism in diverse environments
ccj01130  Biosynthesis of antibiotics
ccj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL81_01165 (sdhA)
   00650 Butanoate metabolism
    UL81_01165 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UL81_01165 (sdhA)
Enzymes [BR:ccj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UL81_01165 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     UL81_01165 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 Pyr_redox_2 Pyr_redox DUF3944 ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: AKE38218
UniProt: A0A0F6QWP9
LinkDB All DBs
Position
227735..229750
Genome map
AA seq 671 aa AA seqDB search
MTNTELKREHPDFTHPKSTIAGVSVGNILESNEPHGVPMKDMWGYHKDHMELVSPLNRRK
FDIVVVGTGLSAGAAAASLGELGYNVKVFTYHDSPRRAHSIAAQGGVNSSRSKKVDNDSA
YRHTKDTVKGGDYRCRESDCWRLASESPRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSTTSALYRQIGLGNVELFAHHDLQDIITYNDNGTKRAGGIVTRNL
ITGELKAFTGHAVILGTGGYGNVYHMSTLAKNSNAGAMMRAYEQGAYIASPAFVQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPVTEGDDRDPKDIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSVYLDFRDAIERLGKDKIRERYSNLISMYEEAIGESA
YETPMRIAPTCHFTMGGLWTDFNEMTAIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLAHHLGEAKLAEDSAEAQEAVQRAQQRIERLMTVQGEAAHGPAYYHRQLG
DILYWGCGVSRNVEDLKTAIQKIRDLRSDFWANVRIPGKADDMNQVLEYGLRVADYLDLG
ELMCIDALDRDESCGAHFRDDHLSEDGEAERDDENWCFVSAWGPGAQEGEFVRHAEPLYF
DSIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgactaacactgaactgaagcgtgagcaccctgacttcacgcacccgaagtccactatt
gcgggcgtgagcgtcggtaacatcctggagtccaacgagccacacggtgttccgatgaag
gacatgtggggctaccacaaggaccacatggagctggtctctccgttgaaccgtcgtaag
ttcgacatcgtggttgttggtaccggcctgtccgctggcgcagctgctgcctccctgggc
gagctgggctacaacgtgaaggtcttcacctaccacgactccccgcgtcgtgcgcactcg
attgctgcacagggtggtgtgaactcctcccgttccaagaaggtggacaacgactccgct
taccgccacaccaaggacaccgttaagggcggcgactaccgttgccgtgagtccgactgc
tggcgcctggcgtccgagtccccgcgcgttatcgaccacatgaacgctattggtgcaccg
ttcgcccgtgagtacggcggcaccctggccacccgttccttcggtggtgtacaggtctct
cgtacttactacacccgtggtcaaacaggtcagcagctgcagctgtccaccacttcggcg
ctgtaccgccagattggcctgggcaacgtggagctgttcgcgcaccacgacctgcaggac
atcatcacctacaacgacaacggcaccaagcgtgccggtggcatcgttacccgtaacctg
attaccggcgagctgaaggccttcaccggccacgcagtcatcctcggtaccggtggttac
ggcaacgtctaccacatgtccaccctggcaaagaactccaatgctggtgcgatgatgcgt
gcttacgagcagggcgcatacattgcttccccggcgttcgtgcagttccacccgaccggc
ctgccggtcaactccgagtggcagtccaagaccattctgatgtccgagtcgctgcgtaac
gacggccgcatttggtccccagtcaccgaaggtgatgaccgcgacccgaaggatattccg
gaagaggagcgcgactacttcctggagcgccgctacccggccttcggcaacctggttccg
cgtgacgtggcatctcgtgccatctcccagcagatcaacaagggcctgggcgttggaccg
ctgcacaactcggtgtacctggacttccgtgacgccatcgagcgcctcggcaaggacaag
atccgtgagcgttactccaacctcatttccatgtacgaagaggccatcggcgagtccgct
tacgagaccccgatgcgtattgcaccgacctgccacttcaccatgggcggcctgtggacc
gacttcaacgagatgaccgccatcgacggcctgttcgccgccggtgagtgctcctggacc
taccacggtgctaaccgcctgggcgctaactccctgctgtccgcatctgttgacggctgg
ttcaccctgccgttcaccatcccgaactacctggctcaccacctgggtgaggccaagctg
gccgaggattccgcagaggctcaggaagcagtacagcgcgcacagcagcgcattgagcgt
ctgatgacggtgcagggcgaggccgcacacggcccggcgtactaccaccgccagctcggc
gacatcctgtactggggttgcggcgtgtcccgtaacgtcgaggacctcaagaccgccatc
cagaagattcgcgacctgcgttctgacttctgggctaacgtccgcatcccgggcaaggct
gacgacatgaaccaggttctcgagtacggtctgcgcgttgctgactacctcgacctgggt
gagctcatgtgcatcgacgccctggaccgcgacgagtcctgtggtgcgcacttccgcgac
gaccacctctccgaggacggcgaggcagagcgtgacgatgaaaactggtgcttcgtttcc
gcttggggaccaggcgctcaggaaggcgagttcgttcgccacgcagagcctctgtacttt
gattcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system